SecReT6
Protein ID: 209395714
SecReT6 ID309
T6SS typei1
Gene symbol-
Locus tagECH74115_0246
StrainEscherichia coli O157:H7 str. EC4115
Repliconchromosome [GenBank: NC_011353] [Browse all T6SS(s) in this replicon]
Location [Strand]262662..262886 [-]
Producthypothetical protein
NoteTssC
UniProt IDB5Z0K3
KEGG IDecf:ECH74115_0246
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|209395714|ref|YP_002268832.1| unnamed protein product [Escherichia coli O157:H7 str. EC4115]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|209395693|ref|NC_011353.1|:c262886-262662 Escherichia coli O157:H7 str. EC4115 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA