SecReT6
Protein ID: 209399492
SecReT6 ID309
T6SS typei1
Gene symbol-
Locus tagECH74115_0240
StrainEscherichia coli O157:H7 str. EC4115
Repliconchromosome [GenBank: NC_011353] [Browse all T6SS(s) in this replicon]
Location [Strand]255990..256514 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDB5Z0J8
KEGG IDecf:ECH74115_0240
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|209399492|ref|YP_002268827.1| unnamed protein product [Escherichia coli O157:H7 str. EC4115]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|209395693|ref|NC_011353.1|:c256514-255990 Escherichia coli O157:H7 str. EC4115 chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGCGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACTGAACCGGACACCAATACCAATGCGGAGGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCAGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGATAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA