SecReT6
Protein ID: 209399715
SecReT6 ID309
T6SS typei1
Gene symbol-
Locus tagECH74115_0235
StrainEscherichia coli O157:H7 str. EC4115
Repliconchromosome [GenBank: NC_011353] [Browse all T6SS(s) in this replicon]
Location [Strand]248953..250365 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB5Z0J3
KEGG IDecf:ECH74115_0235
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 152..183
Protein Sequence: 470 a.a.     [Download]
>gi|209399715|ref|YP_002268822.1| unnamed protein product [Escherichia coli O157:H7 str. EC4115]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKLGSLAHAQLDIPELQRRGLQLLASES
KDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYWTVAAPQNMAHKKRFASQIIKRFETGIEGFSQNAATT
QRDTLLGELAKLAQCWQSHNVPELAQATDDLFALYQRTFNRAAPAPVPTPAASGSSPQTTVTSESGVTQP
SAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSAD
MVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQLTGL
LFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|209395693|ref|NC_011353.1|:c250365-248953 Escherichia coli O157:H7 str. EC4115 chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAAAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGGACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGGTC
TCTGGCCCACGCTCAGCTTGATATTCCCGAACTACAACGCAGGGGGCTACAGCTTCTGGCTTCTGAAAGC
AAAGACTTCAGGCTACTGGCACACCTGCTCAGAACCCTGCAACATGCCGGTGATCCACTGCTGGCACTGC
ACCTGCTAACGCTATACGTGGAACATTACTGGACTGTGGCCGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGATCATTAAACGTTTTGAAACGGGTATTGAAGGCTTTTCACAAAACGCTGCCACAACG
CAGCGCGATACTCTGCTGGGTGAGCTGGCGAAACTGGCGCAGTGCTGGCAGTCACATAACGTCCCGGAAC
TGGCACAGGCTACCGATGATCTTTTTGCCCTGTACCAGCGTACGTTTAATCGTGCGGCTCCTGCTCCGGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAAACCACCGTCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGCCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCTATTTTATGTGAACGCCAGCCGGACTCGCCGCAGGGCTATCGCCTGCGCCGCCATGCCCTGTG
GCAATCCATCACCAGTACACCCCAGGCGGAAAGCGATGGACGTACCCCACTGGCTGCGGTCTCTGCCGAT
ATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGCGCTGTGGCAACAGGTTGAGAAAAGCG
TATTGCTGGCTCCTTACTGGCTGGACGGTCACTGTCTTTCTGCACAGACGGCACTGCGTCTGGGTTACAA
ACAGGTGGCAGACACCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCGCACACCGTTTCTCAGTGAGCAGACGAAACAATGGCTGGCTGCTTCGCCCGACGGCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGCAGGCAGCCAGAGCCTGTTTTGCTGGGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAGGAGGCGGGGCTGATACAGCTTGCGCAGCAACAGTACCGGATGTTGTTGA
TGATAGGGAGTCAGATGATGGTGTCTGACTGGGAGCCATCATTACTTACGCAGCTTGAACAAAAATTCAC
GGCAGAACAATAA