SecReT6
Protein ID: 209399977
SecReT6 ID309
T6SS typei1
Gene symbol-
Locus tagECH74115_0244
StrainEscherichia coli O157:H7 str. EC4115
Repliconchromosome [GenBank: NC_011353] [Browse all T6SS(s) in this replicon]
Location [Strand]260716..261129 [-]
Producthypothetical protein
NoteTssE
UniProt IDB5Z0K2
KEGG IDecf:ECH74115_0244
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-18, Aligned region: 29..118
Protein Sequence: 137 a.a.     [Download]
>gi|209399977|ref|YP_002268831.1| unnamed protein product [Escherichia coli O157:H7 str. EC4115]
MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|209395693|ref|NC_011353.1|:c261129-260716 Escherichia coli O157:H7 str. EC4115 chromosome, complete genome
ATGATACTGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTCATTCGCTCAGGCAATCCATTCGCCAGAACCTAAGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA