SecReT6
Protein ID: 209694666
SecReT6 ID307
T6SS typei1
Gene symbolvasF
Locus tagVSAL_I1114
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1213243..1214070 [-]
Producttype VI secretion protein VasF
NoteTssL
UniProt IDB6EJ68
KEGG IDvsa:VSAL_I1114
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.30E-64, Aligned region: 55..259
Protein Sequence: 275 a.a.     [Download]
>gi|209694666|ref|YP_002262594.1| type VI secretion protein VasF [Aliivibrio salmonicida LFI1238]
MSSMDDRTVLITQDPNQVSPTLTQSPNAPKFDQLQNRMVYAARIKPEEYNFAGNNPLISAASSLLCITCD
LKKETYQDIDLLKPKLVEEIKSFEFQALNSGVENNYVALSRYLLCSFIDEVVVTTPWGAESHWASQSMLS
SFHNETYGGEKFFLLLEKLSRNPAKYLELLELMYLCLSLGFEGKYRVLSRGLIELDAIRDSLYRQIRSLR
GDEKSSLSPNWEPKQVQRHKLTRQTSWVGIVCVVLFSLCAIYGGFYYVLDQQSAHVIQAFEHIEL
 
Nucleotide Sequence: 828 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1214070-1213243 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAGCAGCATGGATGACCGCACGGTACTTATTACCCAAGATCCAAATCAAGTTAGCCCTACGTTAACTC
AGAGCCCCAATGCCCCAAAGTTTGATCAATTACAAAATCGAATGGTGTATGCCGCTCGTATCAAACCTGA
AGAGTACAACTTTGCTGGCAACAATCCACTGATTAGCGCCGCATCGTCTTTGCTTTGTATTACGTGTGAT
TTAAAGAAAGAAACGTATCAAGATATAGATCTACTCAAGCCTAAATTAGTCGAAGAAATTAAATCATTTG
AATTCCAAGCTTTAAATTCAGGCGTTGAGAATAACTACGTCGCACTATCCCGCTATTTACTGTGCTCTTT
TATTGATGAAGTGGTTGTTACTACACCTTGGGGAGCCGAAAGCCACTGGGCATCACAAAGTATGCTTAGT
AGCTTTCACAATGAAACCTATGGCGGTGAGAAGTTTTTTCTGTTGCTTGAAAAGCTAAGTCGAAATCCAG
CTAAGTATTTAGAATTATTAGAGTTAATGTATTTATGCTTAAGCTTAGGTTTTGAAGGTAAATACCGCGT
TTTATCCCGAGGTTTAATTGAATTAGACGCCATTCGAGATTCTTTATACCGCCAAATTCGATCGTTACGT
GGTGATGAGAAATCAAGTCTTTCGCCAAATTGGGAGCCTAAACAAGTGCAACGACATAAGCTGACAAGAC
AAACATCATGGGTAGGCATTGTCTGCGTAGTTCTGTTTTCTTTATGTGCTATCTATGGTGGTTTTTACTA
TGTATTAGACCAGCAATCAGCTCACGTTATTCAAGCATTTGAACACATTGAATTATAG