SecReT6
Protein ID: 209694667
SecReT6 ID307
T6SS typei1
Gene symbolvasE
Locus tagVSAL_I1115
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1214072..1215394 [-]
Producttype VI secretion protein VasE
NoteTssK
UniProt IDB6EJ69
KEGG IDvsa:VSAL_I1115
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.90E-130, Aligned region: 16..438
Protein Sequence: 440 a.a.     [Download]
>gi|209694667|ref|YP_002262595.1| type VI secretion protein VasE [Aliivibrio salmonicida LFI1238]
MQKVIWNEGMLLRPQHFQQNDRYYNHQLQTRTQQQHRFNWGFHSLSFDNHHLSVGKIVINQASGILPDGS
LFDIQHQATPIIWESDEPKTNLTLYLALSLSTVNSPEARSDKEAGINTRYLSYDLTIADNNAQIQNLQTI
SCGELDFHIITEEELDNHWVKLKLCEIKQVTPEGAIQLNQNFEASFINGQHSSLVHRSLREVLTLVTHKA
DILAERITQSGHATSEIGDFLLLQLLNKYEPQLHYLNQCNQYHPEELYLLLATLQGELATYDSAQRRAEL
SLAYNHKEQGDSFERLLFRLRKQLNQSLKQNAFEIPLQKRNHGVLIAPISDTSLLQEASFILAARSHTDA
ETLRKQLPPQLKVGPVEKIRNLVNLQLPGITCRSLSVAPRQVPFHGDYCYFTLDLNANDRSQLTQSGGFA
FHIAGDFPELSLFFWAIRNK
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1215394-1214072 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGCAAAAAGTAATATGGAATGAAGGCATGCTATTACGCCCTCAACATTTCCAGCAAAATGATCGTTATT
ATAATCATCAATTACAAACGAGAACCCAACAGCAACACCGCTTCAATTGGGGATTTCATTCTTTAAGTTT
TGATAATCACCACCTATCTGTGGGAAAAATCGTGATAAATCAAGCCAGTGGTATTTTACCTGATGGTTCA
TTATTTGATATCCAGCACCAAGCAACGCCGATTATTTGGGAATCTGACGAACCAAAAACAAACCTCACAT
TATATTTGGCTTTATCTTTATCCACCGTGAATAGTCCGGAAGCTCGTAGTGACAAAGAAGCAGGCATTAA
CACTCGCTATCTTTCTTATGATCTCACTATTGCAGATAACAACGCTCAAATACAAAACTTACAAACAATC
TCTTGTGGTGAATTAGATTTTCATATCATTACAGAAGAAGAACTAGATAATCACTGGGTAAAATTGAAAC
TCTGTGAAATAAAACAAGTCACTCCTGAAGGCGCAATACAGTTAAACCAAAACTTTGAAGCGAGTTTCAT
TAATGGTCAGCACTCTTCCTTGGTTCATCGCTCTTTGCGAGAAGTATTAACGTTAGTCACTCATAAAGCT
GACATTCTTGCAGAACGAATTACTCAATCAGGCCATGCGACATCAGAGATCGGGGATTTTTTATTACTTC
AATTACTGAATAAATACGAACCTCAATTGCACTACTTAAACCAATGCAATCAATATCATCCAGAAGAGTT
GTACTTATTACTTGCCACACTACAAGGCGAATTAGCAACCTATGATTCAGCTCAACGTCGTGCAGAGTTA
AGTCTTGCTTATAACCATAAAGAACAAGGGGATTCCTTCGAACGCCTTCTTTTCCGTCTTCGTAAACAAT
TAAACCAATCACTCAAACAAAATGCCTTTGAGATCCCACTTCAAAAACGTAATCACGGCGTTCTCATTGC
TCCGATTTCAGATACGAGCTTGTTACAAGAAGCCTCCTTTATTCTTGCCGCCCGTTCTCATACGGATGCA
GAAACGTTACGTAAGCAGCTTCCTCCACAGTTAAAAGTAGGCCCTGTTGAGAAAATTCGAAACTTAGTCA
ACTTACAATTACCAGGAATAACTTGCCGATCGTTATCGGTCGCACCACGACAAGTCCCTTTCCATGGCGA
TTATTGTTATTTTACTCTTGATTTGAATGCGAATGACCGATCTCAATTAACTCAATCAGGAGGTTTTGCG
TTCCATATCGCTGGAGATTTTCCAGAACTGTCCCTCTTTTTTTGGGCTATAAGGAATAAATAA