SecReT6
Protein ID: 209694668
SecReT6 ID307
T6SS typei1
Gene symbolvasD
Locus tagVSAL_I1116
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1215406..1215894 [-]
Producttype VI secretion protein VasD
NoteTssJ
UniProt IDB6EJ70
KEGG IDvsa:VSAL_I1116
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.30E-37, Aligned region: 11..141
Protein Sequence: 162 a.a.     [Download]
>gi|209694668|ref|YP_002262596.1| type VI secretion protein VasD [Aliivibrio salmonicida LFI1238]
MKSLFALLTILMFSGCSNTPEPTYVALTLNASANLNPDHVDRPSPLVIRIIELSSITSLENAEFFDLYNN
AKANLGPDFIAEEEIILRPGDKKIIKLKLSEKGQYLAVIGAYQNIESADWRYIYTVEPEEAQKIELIATD
TSIVKLERVKKKNTTPANNSHI
 
Nucleotide Sequence: 489 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1215894-1215406 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAAATCGTTGTTCGCTTTATTGACGATATTAATGTTCAGTGGCTGTAGCAATACCCCTGAACCAACCT
ACGTTGCATTAACCCTTAATGCTTCGGCAAATCTTAACCCTGATCATGTTGATCGTCCATCACCACTCGT
TATCAGGATCATTGAACTGTCATCAATCACAAGTCTTGAGAATGCCGAATTCTTTGATTTATACAACAAT
GCAAAAGCCAATTTAGGTCCTGATTTTATTGCAGAAGAAGAAATAATCTTACGTCCCGGCGATAAAAAGA
TCATCAAACTAAAATTAAGTGAAAAAGGACAATACCTTGCTGTTATTGGCGCTTATCAAAATATTGAAAG
TGCCGATTGGCGTTATATTTATACCGTTGAACCAGAAGAAGCTCAGAAAATAGAATTGATAGCGACGGAT
ACCTCTATTGTAAAGCTGGAGCGCGTAAAGAAAAAAAACACAACCCCAGCTAATAACTCCCACATTTAG