SecReT6
Protein ID: 209694669
SecReT6 ID307
T6SS typei1
Gene symbolvasC
Locus tagVSAL_I1117
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1215928..1217289 [-]
Producttype VI secretion protein VasC
NoteFha
UniProt IDB6EJ71
KEGG IDvsa:VSAL_I1117
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.20E-13, Aligned region: 53..121
FHA [PF00498], Evalue: 3.20E-13, Aligned region: 285..309
Protein Sequence: 453 a.a.     [Download]
>gi|209694669|ref|YP_002262597.1| type VI secretion protein VasC [Aliivibrio salmonicida LFI1238]
MMITDLLAIRHHKNKQLSFQRRNKMELAFDIIQSQDLPIDTLPTFTFKKAGGTIGRSPNSDWYIADNKRQ
LSNVHVSISYENDQFFISDSSTNGTYLDGQEASLNNGELHPVSHGDIYELGLIKIRARLLQDPENYISPS
QNTLDSSSNDEQSVFNMIPDDSFLSNAPIEELLNTDEDIILKQIEDAVPAQSQMDDTLLKEQFISPVLYD
DFDEENDAASYTGEEQIIEDPIFSTQTRSTDNPIPESKEKTIEKENTAEQSQAYLAALSKGLGIELTNLE
DPEQTLFDVGSALRSSINGIQQLLRTRTEIKNKLTANATTIQAQGNNPIKFSHDVNDALNVIIHHKPGYL
QGIEAINQSCKDIQANQLAIHDACQHTLDALIEKLSPQTLTYRFVQDGIQTKFTKPDALYWQAYKKLHEQ
ISHDSDWRNALLEQDFAKQYESQLQMLSAALRV
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1217289-1215928 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGATGATTACCGACCTGTTGGCAATCCGGCACCACAAGAACAAACAACTCTCGTTTCAGAGGAGAAATA
AAATGGAACTCGCCTTTGATATTATTCAATCACAAGATTTACCTATCGATACCCTACCTACTTTTACCTT
TAAAAAGGCAGGAGGCACCATTGGCCGTAGTCCCAATTCAGATTGGTATATCGCAGACAATAAACGCCAA
CTGTCGAATGTTCACGTATCCATAAGTTATGAAAATGATCAATTTTTCATTTCAGACAGCAGCACAAACG
GAACTTATCTTGATGGGCAAGAGGCTTCACTAAACAACGGGGAATTGCACCCTGTTTCTCATGGTGATAT
TTACGAATTAGGTTTAATAAAAATTCGAGCTCGCTTGCTACAAGACCCAGAAAATTATATTTCACCAAGC
CAAAACACGCTTGATTCTTCCTCAAATGATGAGCAATCTGTCTTTAATATGATCCCTGACGACAGTTTTT
TAAGCAATGCGCCTATCGAAGAATTACTTAACACCGATGAAGACATTATTTTAAAACAAATCGAAGATGC
GGTACCCGCTCAATCTCAAATGGACGATACCTTACTTAAAGAACAATTCATTTCTCCCGTTTTATATGAT
GACTTTGATGAAGAAAATGATGCGGCCTCTTATACCGGAGAAGAACAGATAATAGAAGACCCCATTTTTT
CTACTCAAACTAGATCTACGGATAACCCAATACCAGAATCTAAAGAAAAAACGATAGAAAAAGAGAATAC
TGCCGAACAATCTCAAGCCTATTTAGCCGCGTTATCAAAAGGCCTAGGGATTGAATTAACCAATCTAGAA
GATCCAGAGCAAACATTATTTGATGTTGGTAGCGCATTAAGAAGTTCGATCAATGGCATTCAACAGCTTT
TACGAACCCGAACTGAAATTAAAAATAAACTCACCGCGAATGCCACCACCATTCAGGCTCAGGGAAATAA
CCCAATTAAGTTCAGCCATGATGTCAATGATGCCCTTAATGTCATTATTCACCATAAACCCGGCTATTTA
CAGGGGATTGAAGCCATAAACCAAAGCTGTAAAGACATACAAGCCAACCAACTCGCCATTCATGATGCTT
GCCAACATACCTTGGATGCACTCATAGAAAAGCTATCACCACAGACATTAACATATCGGTTTGTACAGGA
TGGTATTCAAACAAAATTCACAAAACCAGACGCATTGTACTGGCAAGCCTATAAGAAACTGCATGAGCAA
ATAAGTCATGATTCTGATTGGAGAAATGCCTTACTAGAGCAAGACTTTGCGAAACAATACGAATCTCAAC
TGCAAATGTTATCTGCCGCTTTACGCGTGTAA