SecReT6
Protein ID: 209694670
SecReT6 ID307
T6SS typei1
Gene symbolvasG
Locus tagVSAL_I1119
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1218905..1221523 [-]
Productchaperone ClpB
NoteTssH
UniProt IDB6EJ73
KEGG IDvsa:VSAL_I1119
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.30E-42, Aligned region: 208..231
AAA_2 [PF07724], Evalue: 8.30E-42, Aligned region: 593..758
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 211..323
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 598..722
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 188..228
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 255..289
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 341..386
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 577..617
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 662..691
AAA_5 [PF07728], Evalue: 4.90E-12, Aligned region: 211..234
AAA_5 [PF07728], Evalue: 4.90E-12, Aligned region: 597..718
ClpB_D2-small [PF10431], Evalue: 1.20E-11, Aligned region: 764..833
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 198..228
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 595..721
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 211..297
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 344..371
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 595..616
AAA_22 [PF13401], Evalue: 3.70E-07, Aligned region: 659..715
AAA_25 [PF13481], Evalue: 4.70E-07, Aligned region: 211..235
AAA_25 [PF13481], Evalue: 4.70E-07, Aligned region: 593..629
AAA_25 [PF13481], Evalue: 4.70E-07, Aligned region: 824..859
NACHT [PF05729], Evalue: 3.60E-06, Aligned region: 211..238
NACHT [PF05729], Evalue: 3.60E-06, Aligned region: 598..636
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 205..233
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 597..615
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 706..726
AAA_23 [PF13476], Evalue: 3.20E-05, Aligned region: 211..227
AAA_23 [PF13476], Evalue: 3.20E-05, Aligned region: 450..481
AAA_23 [PF13476], Evalue: 3.20E-05, Aligned region: 595..744
DUF258 [PF03193], Evalue: 6.50E-05, Aligned region: 180..230
DUF258 [PF03193], Evalue: 6.50E-05, Aligned region: 564..609
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 205..227
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 593..622
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 191..225
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 262..297
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 596..610
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 668..682
ResIII [PF04851], Evalue: 0.00073, Aligned region: 195..225
ResIII [PF04851], Evalue: 0.00073, Aligned region: 281..293
ResIII [PF04851], Evalue: 0.00073, Aligned region: 568..623
ResIII [PF04851], Evalue: 0.00073, Aligned region: 689..726
Mg_chelatase [PF01078], Evalue: 0.0033, Aligned region: 207..249
Mg_chelatase [PF01078], Evalue: 0.0033, Aligned region: 565..618
AAA_17 [PF13207], Evalue: 0.0036, Aligned region: 212..279
AAA_17 [PF13207], Evalue: 0.0036, Aligned region: 445..449
AAA_17 [PF13207], Evalue: 0.0036, Aligned region: 597..632
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 211..233
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 598..617
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 697..716
T2SE [PF00437], Evalue: 0.0045, Aligned region: 186..231
T2SE [PF00437], Evalue: 0.0045, Aligned region: 548..675
PhoH [PF02562], Evalue: 0.0049, Aligned region: 196..233
PhoH [PF02562], Evalue: 0.0049, Aligned region: 596..615
PhoH [PF02562], Evalue: 0.0049, Aligned region: 668..687
MobB [PF03205], Evalue: 0.0058, Aligned region: 211..232
MobB [PF03205], Evalue: 0.0058, Aligned region: 596..612
AAA_10 [PF12846], Evalue: 0.0058, Aligned region: 209..225
AAA_10 [PF12846], Evalue: 0.0058, Aligned region: 277..296
AAA_10 [PF12846], Evalue: 0.0058, Aligned region: 596..628
AAA_19 [PF13245], Evalue: 0.0069, Aligned region: 208..228
AAA_19 [PF13245], Evalue: 0.0069, Aligned region: 595..619
Protein Sequence: 872 a.a.     [Download]
>gi|209694670|ref|YP_002262598.1| chaperone ClpB [Aliivibrio salmonicida LFI1238]
MINVELPQLIKTLDKESHLALEQAAQLCVTRGGHEVLCEDFILAALNNPQSFWNKACIQYEVSTENLIEA
LQHGRQSRSSESNNPVISTALIEWLQESYLYSMLEMKLSEILSANLLLTLLAHPNKYGHTPYYRELSVIP
LTDLKQQVEGLINSVTENKTVNHEHQDALSAYTTNYTQLAKDNKIDPVLCRDSEIRQMIDILARRRKNNP
MIVGEAGVGKTALVEGLAIKIAQGEVPDILENVSLLSLDLGLLQAGASIKGEFERRLNLVIKAVQQSLTP
IILFIDEAHTLIGAGGQAGSNDAANLLKPALARGELRTIGATTWSEYKKYIEKDPALARRFQPIKVDEPT
VSQAITILRGLADKYEESHGVYVRDDAIVAAAELSARYITGRQLPDKAIDLLDTACARVKINLKAKPQPL
EALFHIIAITQRELNCVLRDKQAGIHIDEKHIYDLENKLQETQSKAQHLEHDWLNQKELAEALLTSRINV
AQCDDSQECEQLLSIQKETYHALMKAQSNQVLVSYETCPSLVAEVISHWTGIPMSTLLRGQASQVLTLHT
QLKQQIKGQDQAIIALQKAIQATAAGLNNPNAPTGVFLFVGPSGVGKTQTALAIADLMYGGEQFLTTINM
SEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAVRQRPYSVILLDEVEKADSEVMNLFYQVFDKGVVNDGEG
REINFKQTLIIMTSNLASEHIESLCNQDELPSVESLTKAIRPILNQYFKPALVARMNIVPFYPLDLESME
ALVDIRMQQLSQQLQKQRIALYYDAHIISHIAKSCTLTETGARNIDAIINGQLKPAFSSQILLALAQKEP
LKAISVNIDEDGQVYCQFEQHGTGEEDVCLPN
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1221523-1218905 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGATTAACGTAGAATTACCACAATTAATAAAAACATTAGATAAAGAGTCACACCTTGCTCTTGAGCAAG
CCGCTCAACTTTGTGTCACTCGCGGTGGTCATGAAGTTCTATGTGAAGATTTTATTTTAGCCGCACTAAA
TAACCCTCAAAGTTTTTGGAATAAAGCCTGTATTCAATATGAGGTATCAACTGAAAATTTAATCGAGGCA
TTGCAACATGGTCGTCAAAGTCGATCCTCTGAAAGCAATAACCCTGTTATCTCTACAGCGCTTATTGAAT
GGCTTCAAGAAAGTTATTTATACTCAATGTTAGAAATGAAACTCTCTGAAATACTCTCAGCTAACTTACT
GTTAACCCTACTGGCACACCCTAATAAATATGGCCATACTCCTTATTACCGTGAATTAAGTGTGATTCCT
TTAACTGACTTAAAGCAACAAGTCGAAGGCTTAATCAATTCTGTTACTGAAAATAAAACAGTCAACCATG
AACATCAAGATGCACTTAGCGCCTATACCACAAATTACACACAATTAGCAAAAGACAACAAGATTGATCC
CGTTCTTTGTCGAGACAGTGAAATCCGCCAAATGATTGATATCTTGGCTCGTCGCCGTAAAAATAATCCT
ATGATTGTTGGTGAGGCGGGTGTTGGAAAAACGGCATTAGTTGAAGGTCTTGCAATAAAAATAGCGCAAG
GCGAAGTCCCTGACATTTTAGAAAATGTCTCATTACTTTCCCTTGATCTTGGTTTATTACAAGCAGGTGC
AAGCATTAAAGGCGAATTTGAACGTCGTCTAAATTTAGTGATCAAAGCAGTACAACAAAGCCTTACTCCG
ATTATTTTATTTATTGATGAAGCTCATACGCTTATTGGCGCTGGTGGGCAAGCAGGAAGTAACGATGCTG
CCAATTTATTAAAACCCGCCTTAGCACGTGGAGAATTAAGAACAATTGGCGCGACAACATGGTCTGAATA
CAAAAAATACATCGAAAAGGATCCGGCTTTAGCTCGTCGCTTCCAACCGATAAAAGTCGACGAACCGACC
GTTTCTCAAGCCATTACGATTCTAAGAGGATTGGCTGATAAATACGAAGAGAGCCATGGTGTCTATGTGA
GAGATGATGCCATTGTTGCCGCCGCTGAATTATCAGCGCGTTATATTACCGGTCGACAATTACCAGACAA
AGCCATTGATCTACTCGATACCGCGTGTGCACGTGTAAAAATAAACCTTAAAGCCAAACCTCAGCCTTTA
GAAGCGTTATTTCATATTATCGCGATTACTCAACGAGAATTAAATTGTGTACTTAGAGATAAGCAGGCAG
GTATTCATATTGATGAAAAGCACATATATGATCTTGAGAATAAACTGCAAGAAACACAGAGCAAAGCACA
ACACCTTGAGCACGATTGGCTTAATCAAAAAGAATTAGCTGAAGCACTATTAACGTCTCGTATTAATGTC
GCTCAATGTGATGACAGCCAAGAATGTGAACAACTTCTGAGTATCCAAAAAGAGACCTATCATGCACTGA
TGAAAGCTCAATCAAACCAAGTCTTAGTTAGTTATGAAACCTGCCCATCACTTGTTGCTGAGGTCATTTC
TCACTGGACCGGAATACCAATGAGTACCTTACTACGTGGACAAGCTTCTCAAGTATTAACGCTTCATACT
CAATTAAAACAACAGATAAAAGGCCAAGATCAAGCCATTATTGCCTTACAGAAAGCAATTCAAGCCACGG
CAGCAGGACTTAATAATCCCAATGCACCCACAGGCGTTTTCTTATTTGTAGGTCCAAGCGGCGTAGGGAA
AACACAAACAGCACTAGCGATTGCTGATTTGATGTATGGCGGAGAACAATTTCTTACCACGATAAATATG
TCCGAATTTCAAGAAAAACACACCGTTTCTCGATTGATCGGCTCACCTCCAGGCTACGTCGGCTATGGTG
AAGGTGGTGTTCTAACCGAAGCCGTACGCCAACGCCCTTATTCTGTCATACTGTTAGATGAAGTTGAAAA
AGCCGATTCTGAAGTCATGAACTTGTTCTATCAAGTCTTTGATAAAGGGGTAGTAAATGATGGTGAAGGT
CGAGAAATAAATTTTAAACAAACCTTAATTATCATGACCTCAAACCTTGCCTCTGAACACATTGAGTCAT
TATGCAATCAAGACGAGTTACCTTCAGTAGAATCACTCACTAAAGCCATTCGTCCAATTCTGAATCAATA
TTTTAAGCCCGCGTTAGTCGCTCGTATGAATATCGTTCCTTTTTACCCACTGGATTTAGAGAGTATGGAA
GCGCTTGTTGATATTCGTATGCAACAATTAAGTCAACAATTACAAAAGCAGCGTATAGCCCTCTACTACG
ATGCTCATATTATTAGCCATATAGCCAAAAGCTGCACGCTAACAGAAACCGGGGCTCGTAATATTGATGC
CATTATTAATGGTCAGCTTAAACCTGCATTTTCATCTCAAATACTATTGGCTCTTGCTCAAAAAGAACCT
TTAAAAGCAATCTCAGTGAATATTGATGAGGATGGGCAAGTATATTGTCAATTTGAACAGCACGGTACAG
GTGAGGAAGACGTATGCCTGCCAAATTGA