SecReT6
Protein ID: 209694671
SecReT6 ID307
T6SS typei1
Gene symbolvasG
Locus tagVSAL_I1120
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1221520..1222449 [-]
Producttype VI secretion protein VasG
NoteTssG
UniProt IDB6EJ74
KEGG IDvsa:VSAL_I1120
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.40E-83, Aligned region: 19..295
Protein Sequence: 309 a.a.     [Download]
>gi|209694671|ref|YP_002262599.1| type VI secretion protein VasG [Aliivibrio salmonicida LFI1238]
MKALDHVCHQLIQYHPWSYDEAYDRIQFIANPSQGFAPREIQTVTVLMQDDGLPKVLLTLNMLSLIGASS
PLPHYYNDYLQQDENNIIKPFLDIFHHRLHRLIRSVWQKYRYNAAFRKGANDPFSQHIFALLGLKSEELR
DDDSINWSRLFPYLGLLSQRVRSANTIEGLLRYYFQHPNIHIEECILRHCKIPNQQQCTLGNTNSLLGAD
VVLGDSTPDRANKFRIHITELTWDHFHSFLTNKPNWITLNRLVRFTVKDPLDFDIQLHLKNDEPRPLTLS
ESNECCLGWTSWLGSKPNEGRITLSGKTL
 
Nucleotide Sequence: 930 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1222449-1221520 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAAAGCCTTAGATCACGTTTGTCATCAACTTATTCAATACCATCCTTGGTCTTATGATGAAGCCTATG
ATCGTATTCAATTCATCGCAAATCCATCACAAGGCTTTGCACCAAGAGAGATACAAACCGTGACCGTTCT
CATGCAGGACGATGGTCTACCAAAAGTACTCTTAACGCTTAATATGCTATCGCTGATTGGGGCTTCATCA
CCTCTGCCTCATTATTATAATGATTATTTACAACAAGATGAAAACAACATCATCAAACCATTTTTAGATA
TTTTCCACCACCGCTTACATCGCCTTATCCGTAGTGTCTGGCAAAAATACCGCTACAACGCTGCTTTTCG
CAAAGGCGCTAATGATCCTTTTTCTCAGCATATTTTTGCATTATTGGGATTAAAAAGTGAAGAGCTACGC
GATGATGATTCAATCAATTGGTCTCGATTATTTCCATACTTAGGGTTACTCAGCCAACGAGTTCGATCGG
CAAATACCATTGAAGGCCTACTTCGTTATTACTTTCAACACCCAAATATACACATTGAAGAGTGCATTCT
ACGCCATTGTAAAATTCCGAATCAGCAGCAATGCACATTAGGAAATACAAACTCCTTACTCGGAGCCGAT
GTTGTTCTTGGTGACAGCACGCCAGATCGTGCAAACAAATTTAGAATTCATATAACTGAATTAACTTGGG
ATCATTTTCATTCATTTTTAACCAATAAACCAAACTGGATCACATTAAATCGCTTAGTTCGATTCACTGT
AAAAGATCCGCTAGATTTCGATATTCAACTTCATTTAAAAAACGATGAACCCCGTCCATTAACGCTATCA
GAAAGTAATGAATGCTGTCTGGGTTGGACAAGTTGGCTCGGCTCAAAACCAAATGAAGGACGCATAACAC
TTTCAGGGAAGACATTATGA