SecReT6
Protein ID: 209694672
SecReT6 ID307
T6SS typei1
Gene symbolvasA
Locus tagVSAL_I1121
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1222512..1224263 [-]
Producttype VI secretion protein VasA
NoteTssF
UniProt IDB6EJ75
KEGG IDvsa:VSAL_I1121
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-170, Aligned region: 3..583
Protein Sequence: 583 a.a.     [Download]
>gi|209694672|ref|YP_002262600.1| type VI secretion protein VasA [Aliivibrio salmonicida LFI1238]
MSFNTYYQTELAALRELGKSFSEENPALAPFLGQEGLDPDIERLFEGFAFLVGRLHQRLDNQLPELTHSL
MRLLWPNYVQAIPAMSTLKFTPNAEATQCSTIPRGTKVKSQLIDGVHCQFKTCYDVELYPISLHSSSFTA
NGNGGIYQLRLELPTGVELHSLNMNKLKIHFNGDKASSLSLIMALCSSTTQAEFCALNSDNELINRSTFP
TKSIKSVGFSSQEALYDYPLNTFEGYRHIQEFFCYPEKYYYIDLTELPVWPAQFSQGCKFIDIKFTLAHI
TQQPFYATRIQPALFCTPIVNLFTTDTQPILLSHRKDQYKVTPSSLSDSSSTILSVEEVHGWTPGQKGRI
NFYHFESFEHNDTNKHANYYSIKQEKNIVNGHFDTYLSFRSLNTFSNNITVSISVTACNGQLAQRLSVGS
ITHATEQTTGSATFSNIRAVTPCYTPPIEKDGLWSLISNMSLNYLSLTKPEAFKRILLAYDFAGQQDDSR
RKKHRRLIDGIKHITTKPSDMLYEGAPVRAMNTQLSLNSKHFLCEGELYLFSSVINEFLSLYTSMNSFNQ
LNVTSTYGGDYSWQPRMGQQPLI
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1224263-1222512 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAGTTTTAATACCTATTATCAAACAGAATTAGCGGCATTGAGAGAGCTTGGAAAATCATTTTCAGAAG
AAAATCCCGCCTTAGCCCCTTTTCTTGGACAAGAAGGGTTAGATCCTGATATTGAACGCTTATTTGAAGG
TTTCGCTTTCTTAGTCGGTCGATTACATCAACGTCTTGATAATCAATTACCTGAGTTAACACATTCATTA
ATGCGATTACTTTGGCCTAACTATGTTCAAGCAATTCCCGCAATGAGTACATTGAAATTTACACCGAATG
CAGAAGCGACTCAATGCTCAACTATCCCCCGAGGGACTAAAGTGAAAAGTCAGTTAATTGATGGGGTTCA
TTGTCAGTTCAAAACCTGCTATGACGTTGAGTTGTATCCAATTAGTTTACATTCATCTTCCTTTACCGCG
AATGGAAATGGCGGGATCTATCAACTACGATTAGAATTACCGACAGGCGTTGAATTACATTCTTTAAATA
TGAATAAATTAAAAATTCATTTTAATGGGGATAAAGCCAGTAGTCTTTCATTAATCATGGCACTTTGCTC
ATCCACTACTCAAGCCGAATTTTGTGCATTAAATAGCGATAATGAGTTAATTAATCGGTCTACCTTTCCA
ACCAAGAGTATCAAATCCGTTGGTTTTTCATCGCAAGAAGCATTATACGATTATCCATTAAACACATTTG
AAGGATACCGTCATATTCAAGAATTCTTTTGCTATCCAGAAAAATATTACTACATTGACTTAACTGAACT
TCCTGTATGGCCAGCTCAGTTTAGTCAAGGATGTAAGTTCATCGATATCAAATTTACCTTAGCTCACATT
ACTCAACAGCCTTTTTATGCTACTCGAATACAACCGGCTCTTTTTTGCACACCCATTGTCAATTTATTCA
CAACGGATACTCAACCGATTTTATTAAGTCATAGAAAAGATCAATATAAAGTAACCCCATCCTCTTTAAG
TGACAGCAGCAGTACTATTTTATCCGTTGAAGAAGTGCATGGATGGACCCCGGGACAAAAAGGTCGCATT
AATTTCTATCATTTTGAATCTTTTGAACATAACGATACAAATAAACACGCCAACTATTACAGCATCAAAC
AAGAAAAAAACATTGTCAATGGTCACTTTGATACATACTTATCTTTTCGTTCATTAAATACATTTTCAAA
TAACATTACGGTATCGATTAGCGTTACCGCATGCAATGGACAACTTGCACAACGCTTATCCGTCGGCAGT
ATTACTCATGCAACGGAACAGACAACAGGATCCGCTACCTTTTCAAATATTCGCGCAGTCACGCCTTGTT
ATACTCCGCCGATTGAAAAGGATGGGCTCTGGTCTTTGATCTCCAATATGTCTCTCAATTACCTCTCATT
AACAAAGCCAGAAGCATTTAAACGCATTTTACTTGCCTATGATTTTGCAGGACAACAGGACGACTCTAGA
AGAAAAAAACATCGTCGATTAATTGATGGTATCAAACACATCACAACAAAACCTTCCGATATGCTTTATG
AAGGTGCGCCTGTTCGAGCAATGAATACCCAATTATCACTTAACAGTAAGCACTTTTTATGCGAAGGCGA
ACTCTACTTGTTTTCATCCGTAATTAATGAATTTTTATCGCTATACACCAGCATGAACTCATTCAATCAA
CTCAATGTGACAAGTACTTATGGAGGCGACTATTCATGGCAACCACGAATGGGGCAACAACCTCTAATTT
AA