SecReT6
Protein ID: 209694673
SecReT6 ID307
T6SS typei1
Gene symbolvasS
Locus tagVSAL_I1122
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1224260..1224685 [-]
Producttype VI secretion protein VasS
NoteTssE
UniProt IDB6EJ76
KEGG IDvsa:VSAL_I1122
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-17, Aligned region: 26..114
Protein Sequence: 141 a.a.     [Download]
>gi|209694673|ref|YP_002262601.1| type VI secretion protein VasS [Aliivibrio salmonicida LFI1238]
MLKQRLFERLLAGNVSMNTSVSVMILTESIKNHVTQLLSTRQGDAKIRPDLGLPDLNISHMTPHDAILHI
KREVERVISQYETRIINTKVNYLGNINSPIHLYFEINGDILLNNQLTPISFNTYAQKVNTKPYNYEIQGL
A
 
Nucleotide Sequence: 426 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1224685-1224260 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGCTTAAACAACGATTATTTGAACGTTTATTGGCCGGGAATGTATCGATGAATACGTCGGTATCAGTAA
TGATATTAACGGAGTCCATTAAAAATCACGTCACTCAATTACTCTCAACAAGGCAAGGTGACGCAAAAAT
TCGTCCCGATTTAGGTTTACCAGATTTGAATATCTCACACATGACGCCTCATGATGCGATTCTGCACATT
AAAAGAGAGGTAGAACGTGTCATCTCACAGTACGAAACTCGAATCATCAATACCAAAGTTAATTATTTAG
GTAATATAAACAGCCCTATTCATCTTTATTTTGAAATCAATGGTGATATTTTATTAAATAACCAACTAAC
GCCTATTTCTTTTAATACTTACGCTCAAAAAGTTAACACTAAGCCTTATAACTATGAAATTCAAGGCCTG
GCATGA