SecReT6
Protein ID: 209694674
SecReT6 ID307
T6SS typei1
Gene symbolvasR
Locus tagVSAL_I1123
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1224773..1226248 [-]
Producttype VI secretion protein VasR
NoteTssC
UniProt IDB6EJ77
KEGG IDvsa:VSAL_I1123
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|209694674|ref|YP_002262602.1| type VI secretion protein VasR [Aliivibrio salmonicida LFI1238]
MSETSTAQEIQKETTIGLLDQIVAQTNLTPEDETYGIAKRGVSAFIQELLKPHNQSEPVKKALIDKMITE
IDQRLSTQVDEILHHSSFQQLESAWRGLKLLVDRTDFRENTKIEIINISKKDLLEDFEDASDITQSGLYK
HVYTNEFGTFGGQPVGAIIGNYDFGPSAPDIKNLQNVAAVAAMAHAPFISAAGPKFFGLDSFEGLPDLKD
LNDHFESPQYAKWQSFRDQEDARYVGLTLPRFLLRQPYDPEENPVKTFNYHENVSATHEDYLWGNTAFTM
ASRVTESFANFRWCPNIIGPQSGGTVEDLPLHHFDSMGDIETKIPTEVLVSDRREFELAEEGFIALTMRK
GSDNAAFFSANSVQKAKLFGNSEEGKSAELNYRLGTQLPYLFIISRLAHYIKVLQREQIGSWKEPTDLER
ELNTWIRQYITDQENPPAEVRSRRPLRAASIEVIDVEGSPGWYKVNLSVRPHFKYMGSDFTLSLVGKLDQ
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1226248-1224773 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGTCTGAAACAAGCACAGCCCAAGAAATACAAAAAGAAACAACGATAGGTCTCCTTGATCAAATCGTTG
CTCAAACTAATTTAACACCAGAGGATGAAACCTATGGTATTGCTAAACGTGGCGTCAGCGCATTTATTCA
AGAGCTATTGAAACCTCATAATCAATCTGAGCCGGTTAAAAAAGCATTAATCGACAAAATGATCACAGAA
ATTGATCAGCGCTTGAGTACTCAAGTTGATGAAATATTACATCACTCTTCATTTCAGCAGCTTGAGTCTG
CTTGGAGAGGACTCAAGTTATTAGTAGATCGCACCGATTTTCGAGAGAACACAAAAATTGAAATCATCAA
CATCTCTAAAAAGGATCTACTCGAAGATTTTGAAGATGCTTCTGACATCACTCAATCCGGTTTATACAAA
CATGTCTATACGAATGAATTTGGTACATTTGGTGGTCAACCTGTCGGTGCTATTATTGGTAATTATGATT
TTGGCCCTTCTGCACCCGATATTAAAAATCTACAAAATGTGGCGGCTGTAGCCGCAATGGCTCATGCCCC
TTTTATTTCAGCGGCGGGTCCTAAATTTTTTGGATTAGATTCTTTTGAAGGGTTGCCTGATCTCAAAGAT
CTTAATGATCATTTCGAAAGCCCACAATATGCAAAATGGCAGAGTTTTAGAGATCAAGAAGACGCCCGTT
ACGTTGGGTTAACCTTACCACGCTTTTTACTTCGTCAACCTTATGACCCTGAAGAAAACCCAGTAAAAAC
ATTTAACTACCATGAGAATGTATCTGCAACTCATGAAGATTACCTATGGGGTAATACCGCGTTTACTATG
GCCTCTCGAGTCACTGAAAGCTTTGCTAATTTCCGTTGGTGTCCAAATATTATCGGCCCTCAATCTGGTG
GTACTGTTGAAGACCTTCCATTGCATCATTTTGACAGCATGGGAGATATCGAAACAAAAATACCCACTGA
AGTTTTAGTGTCTGATCGCCGTGAATTCGAACTAGCAGAAGAAGGATTTATCGCCTTAACCATGCGTAAA
GGTTCAGATAATGCGGCTTTTTTCTCTGCTAATTCGGTTCAAAAAGCCAAATTATTTGGTAATTCTGAAG
AAGGAAAAAGTGCAGAACTAAATTACAGGTTGGGAACTCAACTCCCTTACTTATTTATTATTAGCCGCTT
AGCACATTACATAAAAGTACTACAACGAGAACAAATTGGCAGCTGGAAAGAGCCTACCGATCTTGAAAGA
GAATTGAATACGTGGATAAGACAATACATTACTGATCAAGAAAATCCACCAGCAGAAGTGAGAAGCCGTC
GTCCATTACGCGCCGCAAGCATTGAAGTTATCGATGTTGAAGGAAGCCCTGGTTGGTACAAAGTAAATTT
ATCCGTTCGCCCTCATTTTAAATATATGGGTTCTGATTTTACTTTGTCACTCGTTGGTAAGTTAGATCAA
GAATAA