SecReT6
Protein ID: 209694675
SecReT6 ID307
T6SS typei1
Gene symbolvasQ
Locus tagVSAL_I1124
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1226252..1226746 [-]
Producttype VI secretion protein VasQ
NoteTssB
UniProt IDB6EJ78
KEGG IDvsa:VSAL_I1124
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-54, Aligned region: 5..158
Protein Sequence: 164 a.a.     [Download]
>gi|209694675|ref|YP_002262603.1| type VI secretion protein VasQ [Aliivibrio salmonicida LFI1238]
MSKDGSVAPKERINVTFKPSSGDAAEALELPLKMMVLGDFTLQQDDRKLEDRKPLNIDKSNFNDVIEKQD
LNIEFGVKNRLQDDENEEIPVNLSFKNMTDFDPSSIVEQVPELKGLMDLREALVSLKGPLGNVPAFRKAI
EDALVNDEAREKLLSELGLVTEKE
 
Nucleotide Sequence: 495 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1226746-1226252 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGTCAAAAGACGGATCTGTAGCGCCAAAAGAGCGCATAAATGTGACATTTAAACCATCGTCAGGTGATG
CGGCGGAGGCACTTGAACTTCCTTTAAAAATGATGGTACTAGGTGATTTTACACTGCAGCAAGATGATCG
AAAATTGGAAGATCGTAAGCCTCTCAACATTGATAAAAGTAACTTCAATGATGTGATAGAAAAACAAGAT
TTAAATATTGAATTTGGTGTAAAAAATCGCCTTCAAGATGATGAAAATGAAGAGATCCCAGTAAACCTTT
CATTCAAGAACATGACTGATTTTGACCCTAGCAGTATCGTAGAGCAAGTCCCTGAGCTAAAGGGATTAAT
GGATTTACGCGAGGCACTTGTTTCCCTAAAAGGTCCATTAGGTAATGTTCCTGCATTTAGAAAAGCAATT
GAAGATGCATTAGTCAATGACGAAGCTCGTGAAAAGCTATTAAGTGAATTAGGTTTAGTGACGGAAAAGG
AATAA