SecReT6
Protein ID: 209694676
SecReT6 ID307
T6SS typei1
Gene symbolvasJ
Locus tagVSAL_I1125
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1226761..1228302 [-]
Producttype VI secretion protein VasJ
NoteTssA
UniProt IDB6EJ79
KEGG IDvsa:VSAL_I1125
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-06, Aligned region: 47..107
Protein Sequence: 513 a.a.     [Download]
>gi|209694676|ref|YP_002262604.1| type VI secretion protein VasJ [Aliivibrio salmonicida LFI1238]
MCTYKTILSDLSGENHFGIDLSYETEFESIEKEVVKSTDIFATTKTDWSEVRSNSLNLLQYKSKDYRLLH
WLLLSIKKENDHNTFIIILPIINQFFIKYSTTIYPLREKQLYSTINKIIVIIDDIVKSIIDNSIDTNASN
NLIALLSILDITIDESFNANTDNLYLTINKLSINIKRISSEKKEGSTSSSPLINNEAIKSIASVSFSIDP
ITNDRDANKAFRHLQDIARNLSKFWLTQRINNEKAYQLNRTLTWLHIIQLPASNDEKITMLKPIPQTRLQ
YFIKLKNESDHETLLLEIEESLSKSPFWIDGHLIAWESLIALNHPEAAQIILEQMALLIKKIPEIITLKF
DDGTEFASNSAKNWIAEHCTSAAPSQIAANTYNEISDGTDWEDALQAAQSVLTTDNLSDAILPLITGHNQ
CRSDREVFFWKFSQAKLLYQAHKFDLVCALTSWLDSRYSHSILIHWDPVLEERLLELWLSSQNKLPNKEQ
DTHLMNTLRERLCCLNPMRVLNF
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|209693634|ref|NC_011312.1|:c1228302-1226761 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGTGTACGTATAAAACAATTCTTTCTGACTTATCAGGAGAGAATCACTTTGGCATAGATTTAAGTTATG
AAACTGAATTTGAATCTATTGAAAAAGAAGTCGTAAAATCAACCGACATTTTTGCAACGACTAAAACTGA
CTGGTCAGAAGTTAGATCTAACTCTTTGAATTTACTTCAATATAAAAGTAAAGACTATCGTTTACTTCAT
TGGTTGCTATTATCAATAAAAAAAGAAAATGACCATAATACGTTCATTATTATTCTTCCAATAATTAATC
AATTTTTCATTAAATATAGCACGACTATTTATCCATTAAGAGAGAAACAGCTTTACTCAACGATTAATAA
AATAATAGTAATCATTGATGATATAGTCAAAAGTATAATTGATAATTCAATAGATACTAATGCATCAAAT
AATTTAATCGCATTATTATCAATATTAGATATAACGATTGATGAATCATTTAATGCCAATACCGATAATT
TATACTTAACAATTAATAAACTAAGTATAAATATAAAAAGAATATCATCAGAAAAAAAAGAAGGGAGTAC
TTCCTCATCTCCTTTAATTAATAATGAGGCTATCAAATCAATCGCATCCGTTTCTTTTTCTATCGATCCC
ATTACCAATGATCGCGATGCAAATAAAGCATTTCGACATTTGCAGGATATTGCCCGTAACTTATCAAAAT
TTTGGCTTACTCAACGAATTAACAACGAAAAAGCCTATCAACTAAACCGTACATTAACATGGCTACACAT
CATCCAACTCCCTGCGAGTAACGATGAAAAGATAACCATGTTAAAACCGATCCCACAAACACGACTTCAA
TATTTCATCAAATTGAAGAATGAATCTGATCACGAAACATTATTACTTGAAATAGAAGAAAGCTTGTCAA
AGTCGCCTTTTTGGATAGATGGGCATCTTATCGCTTGGGAAAGCTTAATCGCATTAAACCACCCAGAAGC
AGCTCAAATCATTCTCGAGCAAATGGCATTATTAATTAAAAAGATCCCTGAAATTATCACATTAAAATTT
GATGATGGAACTGAATTTGCGAGTAATAGTGCAAAAAACTGGATCGCAGAACATTGCACCTCAGCAGCAC
CATCTCAAATAGCAGCAAATACTTACAATGAAATAAGTGATGGCACAGATTGGGAAGACGCTTTACAAGC
TGCACAATCGGTTCTCACTACCGACAATTTATCAGACGCAATTCTTCCTTTAATTACTGGACACAACCAA
TGCCGTTCAGACAGAGAAGTTTTCTTTTGGAAGTTTTCACAAGCCAAATTGTTATATCAAGCTCATAAAT
TTGACTTAGTTTGTGCCTTAACAAGTTGGTTAGATTCTCGCTACTCTCACTCAATCTTAATTCATTGGGA
TCCAGTACTAGAAGAACGATTATTAGAATTATGGCTTTCATCTCAAAACAAGCTACCCAATAAAGAACAA
GACACTCATTTAATGAATACATTACGAGAAAGACTCTGTTGCTTAAATCCAATGCGAGTTCTTAATTTTT
AA