SecReT6
Protein ID: 209694716
SecReT6 ID308
T6SS typei5
Gene symbolvasJ-1
Locus tagVSAL_I1169
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1272880..1274265 [+]
Producttype VI secretion protein VasJ-1
NoteTssA
UniProt IDB6EJJ0
KEGG IDvsa:VSAL_I1169
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 68..129
Protein Sequence: 461 a.a.     [Download]
>gi|209694716|ref|YP_002262644.1| type VI secretion protein VasJ-1 [Aliivibrio salmonicida LFI1238]
MRFTQKNILEFQTPIAEDLICGVYLKLDKGAFRPLRNEFNVAQTSLRKLSQNPSSQELESLQDENYENWQ
VLSTSLMTTFENVTRDIELIGWFITSQILLDNSLSSVAYSMNWFAELLAEQWDSINPVLPEEKLKGDSDT
GRLVEQYGAKVKAFFQLLGDSEESSLLYTPLLLLPLVGHVTFYDFQSAERKGELSQLEQQATSLITFDRN
GVRQRLESVADCLFQIERLITITKTYAQIAGVNAPNFNFVKTLFTKYNNALQQLSGMKAEVKVTSTSHKE
KQRLINQSVNTETCGENVLLVEAVSQASDSSIPLRLTADNLSQVGLANSMNRDLAFHLLREVSSYFRQSE
PHSPVSFLLEKAIRWGYLSLPELLQEMMVEQDGDNVNKIFNASGLNHSEQILLPEVGIPPCVIEKTLTFT
ESSSFSEPVNIEAKVAQVSINDTELKQNEDESSSRPTALRW
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1272880-1274265 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAGGTTTACACAAAAAAATATTTTAGAGTTTCAAACTCCTATTGCCGAGGATTTGATTTGCGGAGTTT
ATTTAAAATTAGATAAAGGGGCATTTCGTCCTCTGCGTAATGAGTTTAATGTCGCTCAAACATCTTTACG
TAAACTTAGCCAGAACCCAAGCAGCCAAGAGTTGGAATCTTTACAAGATGAGAATTATGAAAATTGGCAA
GTGTTATCTACTAGCTTAATGACTACTTTTGAAAATGTGACGAGAGATATTGAGTTAATTGGGTGGTTTA
TTACTTCTCAAATTTTACTTGATAACTCACTTAGCAGCGTTGCATATTCAATGAATTGGTTTGCTGAGTT
ATTGGCAGAACAATGGGATTCCATTAATCCTGTATTGCCTGAAGAAAAGTTAAAAGGTGATTCGGATACA
GGACGTTTAGTTGAGCAATACGGCGCGAAAGTGAAAGCGTTTTTTCAGTTACTCGGCGATAGTGAGGAAA
GCAGTTTATTGTATACACCTTTGTTACTGCTGCCGCTTGTTGGTCACGTTACATTTTATGATTTTCAAAG
TGCAGAGCGTAAAGGCGAATTAAGCCAACTCGAACAACAGGCGACATCATTAATTACTTTTGATCGTAAT
GGTGTTCGACAACGATTAGAAAGTGTGGCCGATTGTCTTTTTCAAATTGAACGTTTAATCACTATTACTA
AAACGTATGCTCAAATCGCAGGTGTTAACGCTCCGAACTTTAATTTTGTGAAAACGTTGTTTACTAAATA
TAACAATGCATTGCAGCAGTTATCGGGAATGAAAGCTGAAGTTAAAGTGACGAGTACAAGTCATAAAGAA
AAGCAACGTTTAATTAACCAATCGGTAAATACTGAGACTTGTGGAGAAAATGTTCTATTAGTAGAAGCTG
TTTCTCAAGCGAGTGATTCATCTATACCGCTGAGACTAACAGCAGATAACCTCTCGCAAGTAGGTTTAGC
AAATAGTATGAATCGTGATTTAGCTTTTCATTTACTTCGAGAAGTATCTAGTTATTTCCGTCAGAGTGAG
CCACATAGCCCTGTTTCTTTTTTACTAGAAAAAGCGATTCGTTGGGGGTACTTATCTCTACCTGAGCTAT
TACAAGAAATGATGGTTGAACAGGATGGAGATAATGTTAATAAGATTTTTAATGCATCAGGATTAAACCA
CTCTGAACAGATTCTTCTGCCAGAAGTCGGTATACCTCCTTGTGTCATTGAAAAGACTTTAACGTTTACT
GAGAGTTCTTCTTTTTCAGAGCCTGTAAACATTGAAGCTAAAGTAGCTCAAGTATCTATTAATGATACTG
AACTAAAACAAAATGAAGATGAGTCATCTTCGAGGCCTACAGCGCTTCGTTGGTGA