SecReT6
Protein ID: 209694717
SecReT6 ID308
T6SS typei5
Gene symbolhcp-3
Locus tagVSAL_I1170
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1274426..1274818 [+]
Producthemolysin-coregulated protein Hcp-3
NoteTssD
UniProt IDB6EJJ1
KEGG IDvsa:VSAL_I1170
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-21, Aligned region: 2..101
Protein Sequence: 130 a.a.     [Download]
>gi|209694717|ref|YP_002262645.1| hemolysin-coregulated protein Hcp-3 [Aliivibrio salmonicida LFI1238]
MDIGNGNNADGGMVALSEINLSKQVDGASEDLLSYLFNPGKEGKTVEIAFTKPEADGSGAKLYFQVKLSK
ARLVSYNVAGTDGSQPQENIALSYVEIAQKHNYELDGGEIKDGGIVSYNLPQGKLLSGAQ
 
Nucleotide Sequence: 393 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1274426-1274818 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGGATATCGGTAATGGCAATAATGCTGATGGTGGCATGGTTGCATTGAGTGAAATTAACCTGAGCAAGC
AAGTGGATGGAGCATCTGAAGACTTACTTTCTTACTTATTTAATCCAGGTAAAGAAGGTAAAACAGTAGA
GATTGCATTTACTAAACCTGAGGCCGATGGTTCTGGTGCTAAATTGTATTTCCAAGTGAAATTATCTAAA
GCACGTCTTGTTTCTTATAACGTTGCGGGCACTGACGGCTCTCAACCACAAGAGAATATTGCACTGTCTT
ATGTTGAGATCGCACAGAAGCACAATTACGAATTAGATGGTGGTGAAATTAAAGATGGCGGCATCGTTAG
TTATAACCTACCTCAAGGTAAGTTATTGTCTGGCGCTCAGTAA