SecReT6
Protein ID: 209694718
SecReT6 ID308
T6SS typei5
Gene symbolvasQ-1
Locus tagVSAL_I1171
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1274890..1275399 [+]
Producttype VI secretion protein VasQ-1
NoteTssB
UniProt IDB6EJJ2
KEGG IDvsa:VSAL_I1171
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-56, Aligned region: 7..162
Protein Sequence: 169 a.a.     [Download]
>gi|209694718|ref|YP_002262646.1| type VI secretion protein VasQ-1 [Aliivibrio salmonicida LFI1238]
MALNSQHKRVSKNRVSITYDVETNGAVETKELPFVVGVIGDFSGHKSESEKVDLEEREFTSIDKDNFDMV
MGQVAPTLSYKVDNKLASDESQFEVNMNFSSMKDFHPESVVEQIDPLKKLVETRNQLKVLLSKADRSRDL
ERLLKEILQSTDAIQGLAQELGLNNEGAE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1274890-1275399 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGGCTTTGAATTCACAACATAAGCGTGTTAGTAAAAACCGTGTAAGTATTACTTATGATGTTGAAACAA
ACGGCGCGGTAGAAACCAAAGAATTACCATTTGTTGTTGGTGTTATTGGCGATTTTTCTGGACATAAATC
AGAATCAGAAAAAGTTGATTTAGAAGAGCGCGAATTTACAAGTATTGATAAAGATAATTTCGATATGGTA
ATGGGTCAAGTCGCCCCAACGCTCTCTTATAAAGTTGATAATAAATTAGCGAGTGATGAAAGCCAATTTG
AAGTGAATATGAATTTCAGCTCAATGAAAGATTTTCATCCTGAGAGCGTGGTAGAACAAATAGATCCATT
GAAGAAGTTAGTAGAAACTCGTAATCAACTTAAAGTGCTATTAAGTAAAGCGGATCGTTCTAGAGATCTT
GAGCGATTACTAAAAGAAATCCTACAAAGTACAGATGCAATTCAAGGTTTAGCGCAAGAATTGGGTCTGA
ATAACGAAGGAGCTGAATAA