SecReT6
Protein ID: 209694719
SecReT6 ID308
T6SS typei5
Gene symbolvasRA-1
Locus tagVSAL_I1172
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1275399..1276880 [+]
Producttype VI secretion protein VasRA-1
NoteTssC
UniProt IDB6EJJ3
KEGG IDvsa:VSAL_I1172
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.50E-157, Aligned region: 63..492
Protein Sequence: 493 a.a.     [Download]
>gi|209694719|ref|YP_002262647.1| type VI secretion protein VasRA-1 [Aliivibrio salmonicida LFI1238]
MSTEQQITPEGTIEAGITISILDRAITATAQTPVDTTKELLSILTSQVLDGTVTWDKNLTLTIEKAINAI
DTKISEQLSSVMQNRDFQKLEGTWLGLQKLVKNSDLGADLKIKLADYTKDELLEQFEDAPAIDRSRFFNM
VYQEEFGTAGGQPYGALIGDYEFGYGDEDVALLRYMGEVASASHAPFIAAASASMFDFTTYATFSDGKPV
AAGFDSPAYVSWNAFRASDDSRYVALTLPKTIARQPYGAQTVLVKSFDFEELKTRDNGQQIVGSDEDFVW
SNAAYEFGLLLTRSFTEFGWCTAVRGTESGGKVESLPSFAYYSDAGDLLQQCPTEVNLTDEREKELSELG
FLPLVHYKNTNYAVFMGAQTAHKPRGSLDPDAMANAAISARLPYTMASSRIAQCLKVMGRDLIGSNIDPK
DVEKDLNAWIHKDVNPNAIGNESKARHPLVEAKVTVEEQAGRPGAYSAVAYLRPWLQMEELSTSLRMVAN
IPS
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1275399-1276880 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGTCTACAGAGCAGCAAATAACACCAGAAGGTACTATAGAAGCGGGGATAACAATCAGTATTCTTGATC
GTGCGATTACCGCTACAGCTCAAACACCTGTTGATACAACAAAAGAGCTTCTGAGTATTCTGACTTCGCA
AGTACTTGATGGTACGGTTACGTGGGATAAAAATTTAACTCTTACTATCGAAAAAGCGATTAATGCAATT
GATACTAAAATTTCTGAACAACTTTCATCTGTTATGCAGAACCGTGATTTTCAGAAATTAGAAGGTACTT
GGCTTGGTTTACAAAAGCTAGTTAAAAATAGCGATCTTGGGGCTGACCTTAAAATTAAATTAGCAGATTA
CACTAAAGATGAACTGTTAGAACAATTTGAAGATGCTCCAGCAATCGATCGTAGTCGTTTCTTTAATATG
GTTTACCAAGAAGAGTTTGGTACTGCTGGTGGTCAACCTTATGGCGCTTTGATTGGTGACTATGAGTTTG
GTTATGGTGACGAAGATGTTGCTTTATTACGCTATATGGGTGAAGTAGCCTCCGCTTCTCATGCACCATT
TATTGCAGCAGCAAGTGCAAGCATGTTTGATTTCACTACTTATGCAACTTTCTCAGATGGTAAGCCTGTC
GCAGCAGGTTTTGATTCTCCAGCTTATGTTAGTTGGAACGCTTTCCGTGCAAGTGACGACTCTCGTTATG
TGGCATTAACTCTGCCTAAAACCATCGCACGTCAGCCTTACGGTGCACAAACAGTACTGGTTAAATCATT
TGATTTTGAAGAATTGAAAACACGTGATAATGGCCAACAAATTGTAGGTTCAGATGAAGACTTTGTCTGG
AGTAATGCGGCGTATGAATTCGGTTTATTACTAACGCGGTCATTCACTGAATTTGGTTGGTGTACTGCGG
TTCGTGGTACTGAGAGCGGCGGCAAAGTTGAGAGCTTACCAAGCTTTGCTTATTACTCAGATGCAGGTGA
TTTGCTGCAACAATGCCCAACTGAAGTTAATTTAACTGATGAGCGTGAAAAAGAGCTAAGTGAACTTGGT
TTCCTTCCATTGGTACACTATAAAAATACAAATTATGCCGTATTTATGGGAGCGCAAACGGCTCATAAAC
CAAGGGGGAGCCTTGACCCTGATGCAATGGCAAATGCAGCTATTTCAGCTCGTTTACCATACACAATGGC
AAGTAGCCGTATCGCTCAATGCTTAAAAGTAATGGGTCGAGATCTCATTGGCTCAAACATCGATCCTAAA
GATGTCGAGAAAGATCTAAATGCTTGGATCCACAAAGACGTTAATCCAAATGCGATTGGTAATGAATCGA
AAGCCCGCCATCCATTAGTTGAAGCAAAAGTGACAGTTGAAGAGCAAGCTGGCCGCCCTGGTGCGTATTC
TGCTGTAGCATATTTACGCCCTTGGCTTCAAATGGAAGAATTAAGCACATCATTACGTATGGTTGCAAAT
ATTCCTAGTTAA