SecReT6
Protein ID: 209694720
SecReT6 ID308
T6SS typei5
Gene symbolvasRB-1
Locus tagVSAL_I1173
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1276930..1278291 [+]
Producttype VI secretion protein VasRB-1
NoteTssC
UniProt IDB6EJJ4
KEGG IDvsa:VSAL_I1173
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-118, Aligned region: 38..445
Protein Sequence: 453 a.a.     [Download]
>gi|209694720|ref|YP_002262648.1| type VI secretion protein VasRB-1 [Aliivibrio salmonicida LFI1238]
MNTINQSITMQSELICLPWEELLSLSQKGKTAQFKVLITKLIANLDRVISEQLSTVMQDKHFKKLEASWL
DLQLLTEKQVSSRRVKVKILDLSWSMVSDDLNYSFEIKQTALFKRLYANEFDTGGGTPFGLVVIDHKITS
DYGEDEDHDDLYTLQLLSELAERSLCPVVLGVDEFFFGDDPNRQLHDNVRVKRILDSRDFLSWQLLRDKA
SSRFLHLVLPEYLQRRPYQNYAAGFIFTESNYRDNALWGNSAYLLAGNVIQEFERISWFGFLRSYNETGT
YGAIIQHDLSLTAKVDIYNEDDGFWAEQGFVPLSSLYLTEQKGFFSNQSVWKASTEELQMLGTLQTNLMA
CRFGHYIKAQLRDQIGRYDSMEDCKRGLENWLKSYISEVDYGEDSVMARYPLKASEVRIKEDSQDSTRYL
CEIMLQPQYQYEMMDAQVLLTTSMPDQAVGGSA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1276930-1278291 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAATACAATCAATCAATCAATAACGATGCAATCAGAGTTAATATGCTTACCTTGGGAGGAATTATTAT
CACTCTCTCAAAAAGGCAAAACTGCTCAATTTAAAGTATTGATTACTAAACTAATCGCTAATTTAGATCG
TGTGATTAGCGAACAACTTTCAACAGTTATGCAAGACAAACACTTTAAAAAACTGGAAGCAAGTTGGCTT
GATCTTCAGTTATTGACAGAAAAACAAGTCTCATCGCGAAGAGTTAAAGTTAAAATATTAGATCTAAGTT
GGAGCATGGTGTCAGATGATCTAAATTACTCGTTTGAAATAAAGCAGACTGCTCTATTTAAAAGATTATA
CGCCAATGAATTTGATACTGGAGGTGGGACCCCTTTTGGTCTTGTTGTTATTGATCATAAAATTACGTCT
GATTATGGTGAAGATGAAGACCATGATGACCTTTATACTTTGCAACTATTATCAGAGCTTGCGGAGCGCT
CGTTATGTCCAGTGGTGCTAGGGGTTGATGAGTTTTTCTTCGGTGATGATCCTAATCGCCAACTACATGA
TAACGTGAGAGTAAAACGAATTTTAGATAGTCGTGATTTTCTTTCATGGCAATTATTAAGAGATAAAGCC
TCTTCTCGTTTTTTGCATTTGGTTTTACCTGAGTATTTACAACGTCGTCCTTATCAAAATTATGCTGCGG
GGTTTATTTTTACTGAAAGTAATTATCGTGATAATGCGCTTTGGGGAAACAGTGCGTATTTACTTGCAGG
AAATGTTATTCAAGAATTTGAACGCATTAGTTGGTTTGGTTTTTTGCGTTCATATAATGAAACAGGTACA
TATGGAGCGATCATTCAACATGATTTATCACTTACCGCTAAAGTTGATATTTATAATGAGGATGATGGTT
TTTGGGCAGAACAAGGTTTTGTTCCACTAAGTAGTTTGTATTTAACGGAACAAAAAGGATTCTTTAGTAA
TCAATCGGTTTGGAAAGCATCAACAGAAGAACTCCAAATGTTGGGGACGTTACAAACTAACTTAATGGCA
TGTCGTTTCGGGCACTATATTAAAGCTCAGCTCCGAGATCAAATCGGCCGTTACGATAGCATGGAAGATT
GCAAACGTGGTTTAGAGAACTGGTTAAAATCTTATATTAGTGAAGTCGATTATGGTGAAGATTCAGTGAT
GGCTCGTTATCCATTAAAAGCGAGTGAAGTACGTATCAAAGAAGATAGCCAAGACAGCACTCGTTATTTA
TGCGAAATCATGCTTCAGCCTCAGTATCAATATGAAATGATGGATGCTCAAGTATTATTAACAACTTCTA
TGCCTGATCAAGCAGTGGGAGGGTCTGCATGA