SecReT6
Protein ID: 209694721
SecReT6 ID308
T6SS typei5
Gene symbolvasS-1
Locus tagVSAL_I1174
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1278288..1278710 [+]
Producttype VI secretion protein VasS-1
NoteTssE
UniProt IDB6EJJ5
KEGG IDvsa:VSAL_I1174
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-10, Aligned region: 16..117
Protein Sequence: 140 a.a.     [Download]
>gi|209694721|ref|YP_002262649.1| type VI secretion protein VasS-1 [Aliivibrio salmonicida LFI1238]
MSLMAKLTQSWTNDVDAVRDAIIDNICDLISSRAPIWPTLESSDELADTIAYSGLRNMTRAQSKSNSDVI
IVDITHLIRCYEPRLIDVLIEVEEKEKSKNQLQFRISATMLSDQGEEAIVLNSFLDLSRNILDVRKSNFV
 
Nucleotide Sequence: 423 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1278288-1278710 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAGCTTAATGGCGAAGTTAACTCAATCTTGGACTAATGATGTGGATGCGGTGCGTGATGCGATTATTG
ATAATATTTGTGATCTTATTTCAAGTCGAGCTCCAATTTGGCCAACGTTAGAATCATCAGATGAATTGGC
TGATACGATTGCCTATTCTGGATTACGTAATATGACTCGTGCACAGAGTAAATCGAATAGTGATGTGATT
ATTGTTGATATTACTCATTTGATCCGTTGCTATGAACCTAGGTTAATTGATGTCTTGATAGAAGTAGAAG
AAAAAGAAAAATCAAAAAATCAATTACAGTTTCGTATTTCTGCGACGATGTTATCTGACCAAGGCGAAGA
AGCCATTGTATTGAATTCCTTTTTGGATCTAAGTCGAAACATATTGGATGTAAGGAAATCAAATTTTGTC
TGA