SecReT6
Protein ID: 209694722
SecReT6 ID308
T6SS typei5
Gene symbolvasA-1
Locus tagVSAL_I1175
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1278703..1280484 [+]
Producttype VI secretion protein VasA-1
NoteTssF
UniProt IDB6EJJ6
KEGG IDvsa:VSAL_I1175
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.60E-154, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|209694722|ref|YP_002262650.1| type VI secretion protein VasA-1 [Aliivibrio salmonicida LFI1238]
MSDTLLTYFEQELRFIREEASYFSARHPGATEALGIRKDSIDDPQISRLIESVAFLNGRLQQRLDDSFPE
FTESLIRLLFPHYLRPIPSYSLLDFVVNNDTNATHHIPSGTEFEVRDEQINSAIFRTTEEVALYPLKIER
VNVSFAPFELEKPKGAEQSNALIEISISTVDDTVVLSELLIESLKLHFKGETNFALRLFDLLSQGTSQIC
VSAQGKSYELSRNAMKPVGFEVNDTILPYQAASFGGFKLLTEFFMFSERFNGFHFNFGDVLKQIDSHQFK
LQIFIDELSVDFARSLSAERFSLFTTPIVNLHQMVSDPLDVDFFKKQYPIILDANQGHNLELFSVDEVMD
VTQVEPTKIAQIYGEKFNGSESGLRWQLVQTLHENGLLESALKVADLEHISAESESQTWLVNATVTDGMV
TSHLSLLSEIECRESLTIPADIQLLRRPSLPMRSKETNKNVWTLLCHLHFNYHSILGSDDPVETLKNVFD
LYNHNQNPQNYAYIESVTTIEQEQVVAPIRISGKTCFAYGTKITITLDPTNVNGGICLFGHILERFFAYF
AGFNSFTQVNIKLKGQDELYMAFPRRSGCKILL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1278703-1280484 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
TTGTCTGATACATTACTGACATATTTTGAACAAGAACTGCGCTTTATTCGAGAGGAAGCGTCGTATTTTT
CAGCTCGTCATCCGGGAGCTACAGAAGCACTCGGCATAAGAAAAGACAGTATTGATGATCCTCAAATTTC
CCGTTTAATTGAAAGCGTGGCTTTTTTGAATGGTAGATTACAACAGCGTTTAGACGATTCTTTTCCTGAA
TTTACTGAAAGTCTTATTCGTTTACTTTTTCCTCATTACTTACGTCCAATTCCTTCGTATAGCTTGCTTG
ATTTTGTGGTTAATAATGATACCAATGCCACTCACCATATTCCGTCAGGAACAGAGTTTGAAGTGCGTGA
TGAACAGATCAATAGTGCCATATTTCGTACAACAGAAGAGGTAGCCCTTTACCCTTTAAAAATAGAAAGA
GTTAACGTTTCTTTTGCTCCATTTGAGTTAGAAAAACCAAAAGGTGCAGAACAATCAAATGCTTTGATAG
AAATATCGATCTCTACGGTGGATGATACCGTTGTACTTTCTGAATTATTGATTGAATCATTAAAGCTTCA
TTTTAAAGGTGAAACCAACTTTGCATTGCGATTGTTTGATCTTTTATCACAAGGTACATCTCAAATTTGT
GTCTCAGCACAAGGTAAAAGCTATGAGCTAAGTAGAAATGCAATGAAGCCTGTTGGTTTTGAGGTTAATG
ATACGATTCTTCCTTATCAAGCGGCGAGCTTTGGTGGCTTTAAGTTGTTAACTGAATTCTTTATGTTTTC
AGAGCGATTTAATGGTTTTCATTTTAATTTTGGTGATGTATTAAAGCAGATCGATAGTCATCAATTTAAA
CTTCAAATATTTATTGATGAATTAAGTGTAGATTTTGCTAGAAGCTTATCTGCCGAACGTTTTTCACTAT
TTACCACACCGATAGTGAATTTACATCAAATGGTTTCAGATCCGCTTGACGTTGATTTTTTTAAGAAACA
ATACCCAATAATACTTGATGCAAATCAAGGGCATAATTTAGAGCTATTTTCAGTTGATGAAGTTATGGAT
GTTACACAAGTAGAACCTACCAAAATAGCTCAAATTTATGGTGAAAAATTTAATGGTAGTGAATCAGGGT
TGCGTTGGCAGTTAGTGCAGACTCTACATGAAAATGGTTTGTTAGAAAGTGCATTAAAAGTAGCTGATCT
GGAGCATATTAGTGCAGAAAGTGAATCTCAAACTTGGTTAGTGAATGCAACGGTGACTGATGGCATGGTA
ACGAGCCATTTATCATTATTAAGTGAAATTGAATGTCGTGAATCATTAACTATTCCAGCAGATATCCAGT
TATTACGTCGACCATCATTACCTATGCGTAGTAAAGAAACCAATAAAAATGTATGGACTTTACTGTGTCA
TTTACATTTTAATTACCATTCTATTTTAGGCTCAGATGATCCTGTTGAAACATTAAAAAATGTATTTGAT
TTATATAATCATAATCAAAACCCACAAAATTACGCTTATATCGAATCTGTAACGACAATAGAGCAAGAAC
AAGTAGTCGCTCCAATTCGAATATCAGGAAAAACATGTTTTGCTTACGGAACGAAGATAACAATCACTCT
TGATCCTACTAATGTGAATGGAGGGATCTGCTTGTTTGGCCATATTCTTGAACGCTTCTTTGCGTATTTT
GCAGGGTTTAATAGTTTTACTCAGGTAAATATTAAGTTGAAGGGACAAGATGAGCTTTATATGGCCTTTC
CAAGGAGATCTGGATGCAAAATTTTGTTGTAG