SecReT6
Protein ID: 209694723
SecReT6 ID308
T6SS typei5
Gene symbolvasB-1
Locus tagVSAL_I1176
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1280466..1281449 [+]
Producttype VI secretion protein VasB-1
NoteTssG
UniProt IDB6EJJ7
KEGG IDvsa:VSAL_I1176
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-45, Aligned region: 34..311
Protein Sequence: 327 a.a.     [Download]
>gi|209694723|ref|YP_002262651.1| type VI secretion protein VasB-1 [Aliivibrio salmonicida LFI1238]
MQNFVVVRLNNNQQDVELDKAWQLFKHQAEHNGVRPNIAFSAEQLPAYYQTQVTEVYRNNIGNYVIKTPL
AALSGCKGTIPRQMYRQVLSAQFDLGDEAPVDFFDVFNNRYFRLYCQAELKHDLSSQAEEETFTWNLHQQ
SLTTMLSSLCGLGENNSAIPKQDLIQYTGLLGLKLTCPFALKLLLEDYFDAEFVIKTSELEYQPLTPCTL
TQLGKIGQNRQLGMGALVGKSAPMVGQKLHIKVCPRNYSHYIKIRSDRKMISAIEHLVRSYMGINIKYKL
YMKVDSRYLPRVQLTSNADKGLKVGQSAWMNSRLNKQQHVEMLLTTS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1280466-1281449 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGCAAAATTTTGTTGTAGTACGTTTAAATAATAATCAACAAGATGTTGAGTTAGATAAAGCGTGGCAGC
TATTTAAGCATCAAGCTGAGCATAATGGAGTTCGTCCGAATATAGCTTTTAGCGCAGAGCAACTGCCTGC
GTATTACCAAACTCAAGTTACTGAAGTATACCGAAATAATATTGGTAATTATGTAATCAAGACGCCTTTA
GCAGCTTTGTCGGGTTGTAAAGGAACGATACCAAGGCAAATGTATCGTCAGGTATTGAGTGCTCAATTTG
ATTTGGGTGATGAAGCACCAGTTGATTTCTTTGATGTATTTAACAACCGCTATTTTCGTTTGTATTGCCA
AGCAGAGTTGAAGCATGACTTAAGTAGTCAAGCTGAGGAAGAAACCTTTACATGGAACCTTCACCAGCAA
TCATTGACAACCATGCTATCGAGCTTATGTGGTCTTGGTGAAAATAATAGTGCGATTCCAAAACAGGATT
TAATTCAATATACCGGTTTATTGGGTTTGAAATTAACTTGTCCGTTTGCGCTCAAGTTATTGTTAGAAGA
CTATTTTGATGCTGAGTTTGTGATAAAAACAAGTGAGTTAGAGTACCAACCTTTAACGCCTTGTACATTA
ACGCAGTTAGGTAAAATAGGACAGAATAGGCAGTTAGGTATGGGAGCACTCGTTGGAAAAAGTGCACCTA
TGGTTGGCCAAAAGTTACATATTAAAGTGTGTCCACGAAATTATAGTCACTATATTAAGATTCGTAGTGA
TAGAAAAATGATTAGTGCCATTGAGCATTTAGTACGAAGTTACATGGGAATTAACATTAAATATAAGCTT
TACATGAAAGTGGATAGCCGATATTTGCCAAGAGTTCAACTAACTAGTAATGCAGACAAAGGCTTAAAAG
TAGGTCAATCAGCCTGGATGAACAGTCGTTTAAACAAGCAACAGCATGTTGAAATGCTACTAACAACAAG
TTAA