SecReT6
Protein ID: 209694726
SecReT6 ID308
T6SS typei5
Gene symbolvasC-1
Locus tagVSAL_I1179
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1284376..1285320 [+]
Producttype VI secretion protein VasC-1
NoteFha
UniProt IDB6EJK0
KEGG IDvsa:VSAL_I1179
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.30E-12, Aligned region: 29..97
FHA [PF00498], Evalue: 3.30E-12, Aligned region: 218..233
Protein Sequence: 314 a.a.     [Download]
>gi|209694726|ref|YP_002262654.1| type VI secretion protein VasC-1 [Aliivibrio salmonicida LFI1238]
MPISIRIISSPDGESISEWNKLLPEEGGSIGRAFGASIQLSDAIREVSASHAIIKKTSRGYQIIDDSTNG
LFINGSDKPLGLSNQTALNDGDILDIGRYRLLVSCFVPEQAQIQDFSTLSEDFSLGGDPFNISEVEPSFS
SSFVHKEPELDFAFSDCNIIGDNPFNIEDIKKVQEHKEVNLSFVALDDDPFSGSELQLNLPLESKEGKAS
IQESADDKYAFIVDQKSEERTQLHMNRALEMALTRLLSDISPHAMEDMFDEISRPSFFSGVPKYWDMYKR
YFTRQVENKDWQIKFHAYFHDAIRLQRNLERGNK
 
Nucleotide Sequence: 945 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1284376-1285320 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGCCTATATCGATAAGAATAATTAGCTCGCCAGACGGAGAAAGTATCTCTGAGTGGAATAAACTACTTC
CTGAAGAAGGAGGAAGTATCGGTCGTGCTTTTGGTGCTTCTATTCAATTAAGTGATGCTATTCGAGAGGT
CTCAGCCTCTCATGCCATCATTAAAAAAACATCTCGTGGTTATCAAATCATCGATGATAGTACTAATGGT
TTATTTATTAATGGTTCAGATAAACCGCTTGGTTTAAGTAATCAAACAGCATTAAATGATGGAGATATTC
TTGATATCGGTCGTTATCGCTTATTGGTGTCTTGTTTTGTTCCTGAACAAGCCCAGATACAGGATTTTTC
AACGTTATCTGAAGACTTCTCATTAGGAGGTGACCCTTTTAATATCTCTGAAGTTGAGCCTTCGTTTTCT
TCAAGTTTTGTTCATAAAGAACCGGAATTAGATTTTGCGTTTTCTGATTGCAATATTATTGGTGATAACC
CGTTTAATATCGAAGATATAAAAAAAGTACAAGAACATAAAGAAGTAAATTTAAGCTTTGTGGCATTAGA
TGATGACCCATTTTCAGGTTCAGAGCTTCAATTAAATTTACCTTTAGAATCAAAGGAAGGTAAAGCCTCA
ATACAAGAAAGCGCAGATGATAAATACGCATTTATAGTTGATCAAAAAAGTGAAGAACGAACGCAGCTAC
ATATGAATAGAGCCCTAGAAATGGCGTTAACCCGTTTGTTGTCAGATATTTCACCTCATGCAATGGAAGA
TATGTTTGATGAGATTTCAAGACCAAGTTTTTTTAGTGGTGTACCAAAATATTGGGATATGTATAAGCGT
TATTTTACTCGACAAGTTGAAAACAAAGATTGGCAAATTAAATTTCATGCTTATTTTCATGATGCAATCC
GTCTGCAGCGTAACCTAGAACGAGGCAACAAATGA