SecReT6
Protein ID: 209694727
SecReT6 ID308
T6SS typei5
Gene symbolvasD-1
Locus tagVSAL_I1180
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1285317..1285781 [+]
Producttype VI secretion protein VasD-1
NoteTssJ
UniProt IDB6EJK1
KEGG IDvsa:VSAL_I1180
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.10E-36, Aligned region: 11..144
LPAM_1 [PF08139], Evalue: 0.0023, Aligned region: 1..18
Protein Sequence: 154 a.a.     [Download]
>gi|209694727|ref|YP_002262655.1| type VI secretion protein VasD-1 [Aliivibrio salmonicida LFI1238]
MRKWLMSSIVVLLLSGCSFSGEEFTPQVVLNIKAASNINPNVEGKPSPLELRVYQLTDSQAFSQADFIQI
YNDEQGVLKAELLLARQLESILPGETRQEVFPLAAETKYIGVIAEFAAYREAKNKVIYKPIILGITAINI
EVDGINLSVSGEEE
 
Nucleotide Sequence: 465 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1285317-1285781 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGAGAAAGTGGTTAATGTCATCTATTGTTGTTTTGTTACTATCAGGTTGTAGTTTTAGTGGTGAAGAAT
TTACTCCTCAAGTTGTACTTAATATAAAAGCTGCTTCAAATATCAACCCTAATGTAGAAGGAAAGCCTTC
ACCGTTAGAATTACGTGTATATCAGTTAACTGATAGTCAAGCGTTTTCACAGGCAGATTTTATTCAAATT
TATAATGATGAGCAGGGTGTCTTAAAAGCAGAGTTATTACTTGCTCGTCAATTAGAAAGCATTTTACCAG
GAGAAACACGTCAAGAAGTATTTCCTCTTGCTGCAGAAACTAAATATATCGGTGTTATTGCAGAGTTTGC
TGCCTACCGTGAAGCAAAAAATAAAGTTATCTATAAACCGATAATCTTAGGAATTACAGCCATTAATATT
GAAGTCGATGGGATTAATCTATCAGTATCAGGCGAAGAGGAATAA