SecReT6
Protein ID: 209694728
SecReT6 ID308
T6SS typei5
Gene symbolvasE-1
Locus tagVSAL_I1181
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1285784..1287100 [+]
Producttype VI secretion protein VasE-1
NoteTssK
UniProt IDB6EJK2
KEGG IDvsa:VSAL_I1181
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-102, Aligned region: 18..438
Protein Sequence: 438 a.a.     [Download]
>gi|209694728|ref|YP_002262656.1| type VI secretion protein VasE-1 [Aliivibrio salmonicida LFI1238]
MDNKKVVWSEGMFLSPQHFQQQTRYIEHLTREFTEQIAPQGSGLTLLELDRSMLNIGKVSVRRARGIFQD
GTPFEINRGLVLDIPKNTNHKKVYLALSVSRPGAVDVGANQHLRHSSVDHPVFDTSREHCESVLLEIAEL
NIVLKLEDEELQDYTLISVCEVIEHKSEGAVLLNQAFVPHCLQFGVSNYLKDSVADVLAQVQYRVMTIST
RLQTENDSKSYQAMMRDYLWLQALGAWMPKLQQWNQDGSLLTKHLYLECLSMAGQMQGLEGKMPKDSLVW
DQNNLYSIFSVIFSELLVLLREVQIDNLTTLSWDKQLFVSRRLLRTLVKDRSLYNEGRFILVATSPLGAS
RLSEEFPKAIKLAGNSDIAGLVRNALSGVGLRNLPYAPSELKSKHDAAYFEIDTKSELWQALVKNDEPIA
LHIDDRIEDVHVEFHVIR
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1285784-1287100 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGGACAATAAAAAAGTCGTTTGGAGTGAAGGAATGTTTCTTTCTCCGCAGCATTTTCAACAGCAAACAC
GTTATATTGAACATTTAACTCGTGAATTTACAGAACAAATTGCACCTCAAGGAAGTGGACTAACCTTACT
TGAACTTGATCGCTCTATGCTTAATATAGGTAAAGTTTCTGTTCGTCGGGCAAGGGGGATCTTTCAGGAT
GGAACGCCATTTGAAATTAATCGTGGTCTTGTTTTAGATATACCTAAAAATACAAATCACAAAAAAGTAT
ATCTTGCTTTATCTGTATCACGACCTGGTGCGGTAGATGTTGGGGCCAATCAGCATTTACGTCATTCTTC
TGTAGATCATCCAGTATTCGATACTAGTCGTGAGCACTGTGAATCAGTACTGCTAGAGATTGCTGAGCTT
AATATTGTTTTAAAATTAGAAGATGAAGAGTTACAAGATTACACTCTCATATCCGTTTGTGAGGTAATTG
AGCATAAATCAGAAGGTGCAGTACTTCTTAATCAAGCTTTTGTACCGCATTGTTTGCAGTTTGGAGTATC
TAATTATCTGAAAGATAGTGTGGCTGACGTTTTAGCCCAAGTGCAGTATCGTGTAATGACAATATCGACT
CGACTGCAAACTGAAAATGACAGTAAAAGTTATCAAGCGATGATGCGTGATTATTTATGGCTGCAAGCCT
TAGGTGCTTGGATGCCTAAATTACAACAATGGAATCAAGATGGCAGCTTATTAACTAAACACTTGTATTT
AGAATGCCTGTCAATGGCAGGTCAAATGCAAGGTCTTGAAGGAAAAATGCCTAAAGACTCTTTAGTGTGG
GATCAAAACAACTTATACAGCATCTTTTCTGTGATTTTCTCTGAATTATTAGTGTTGTTACGTGAAGTTC
AAATAGATAACTTAACAACTTTATCATGGGATAAGCAATTATTTGTTTCTCGACGTTTACTCCGCACATT
AGTTAAAGATCGCAGTTTATATAATGAAGGACGTTTTATTCTGGTTGCTACGTCCCCCTTAGGTGCATCG
CGTCTTAGTGAAGAGTTTCCTAAAGCGATTAAACTTGCAGGTAATAGTGATATTGCGGGTTTAGTTCGTA
ATGCCTTATCCGGTGTTGGGTTACGAAACCTGCCTTATGCGCCTTCAGAGCTTAAATCTAAACACGATGC
CGCGTATTTTGAAATTGATACTAAATCTGAATTATGGCAAGCCTTAGTGAAAAATGATGAGCCTATCGCC
TTGCATATCGACGACCGTATCGAAGATGTTCACGTTGAATTTCATGTAATTAGGTAG