SecReT6
Protein ID: 209694729
SecReT6 ID308
T6SS typei5
Gene symbolvasF-1
Locus tagVSAL_I1182
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1287108..1288232 [+]
Producttype VI secretion protein VasF-1
NoteTssL
UniProt IDB6EJK3
KEGG IDvsa:VSAL_I1182
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-50, Aligned region: 50..249
Protein Sequence: 374 a.a.     [Download]
>gi|209694729|ref|YP_002262657.1| type VI secretion protein VasF-1 [Aliivibrio salmonicida LFI1238]
MSELFNDEATIELRHTKEKIPAKKKNAELKDIDLLGAEWLIDNLSVYNSSLLNSATELFAILVTLSRQGE
PRDINRFRQRLLDEISVFRQRGAHLEYHPSIIEKSCFVLCAAFDEAILYTQWGESARWENHSLLSKVFSQ
RNGGEAFFTLLDKASQQPAKLVDFLELQYVLLMLGFKGRFRHDNENVLHEIQSNVYSIIRHYRSESVLPV
PKIPELIEGKQPWLMLSMSKTLVIAFFITIIVYGASEYWYFNRSQPILAQFNAINTSSVGKKNNKELINI
SSGSDIGKIVDNRKQELKETLQWEVVLAAFTRSLDAVRLVSELQQAGYEPFTRETDHGVELYIRAGDNLS
VIRKLKNELNIRFDLNATIKRAQI
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1287108-1288232 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
GTGAGTGAATTATTTAATGACGAAGCGACAATAGAACTTCGTCATACTAAAGAAAAAATACCGGCAAAGA
AAAAAAATGCAGAACTTAAGGATATAGATCTCTTAGGTGCAGAGTGGTTGATTGATAACCTCTCTGTTTA
TAATAGCTCGTTATTGAATTCTGCAACTGAGCTATTTGCAATTTTGGTCACTTTATCTCGTCAAGGCGAA
CCGCGAGATATAAATCGATTTAGGCAACGTTTGTTGGATGAAATATCTGTATTTCGCCAACGTGGAGCAC
ATCTTGAATATCACCCAAGTATTATAGAAAAAAGTTGTTTTGTATTATGTGCCGCTTTTGATGAAGCCAT
TCTTTATACGCAATGGGGGGAAAGTGCTCGTTGGGAAAACCATTCATTATTAAGTAAGGTTTTTTCTCAA
CGTAACGGGGGCGAAGCTTTTTTTACATTATTGGATAAAGCGAGCCAACAGCCAGCAAAATTAGTAGATT
TTTTAGAATTGCAATACGTTTTACTTATGTTGGGATTTAAAGGACGTTTCCGTCACGATAATGAAAATGT
TTTACATGAAATTCAATCAAATGTGTATTCCATTATTCGTCATTATCGCAGTGAATCTGTATTACCTGTA
CCAAAAATACCAGAACTAATTGAAGGTAAACAACCATGGTTAATGCTAAGTATGTCGAAAACATTAGTGA
TTGCTTTCTTTATCACAATCATAGTTTATGGTGCGTCAGAGTATTGGTATTTTAATCGTAGCCAGCCAAT
TCTTGCACAATTTAATGCTATCAATACGTCTAGTGTAGGTAAGAAAAATAACAAAGAATTAATTAATATT
AGTTCGGGTTCAGATATTGGGAAAATAGTTGATAATAGAAAACAAGAACTTAAAGAAACTCTGCAATGGG
AAGTTGTGCTTGCTGCATTTACTCGTTCATTAGATGCTGTGCGGTTGGTGTCAGAATTACAGCAAGCGGG
GTATGAACCATTCACACGAGAAACAGACCATGGTGTCGAGCTTTATATTAGAGCTGGAGATAATTTATCG
GTTATACGAAAGCTCAAAAATGAATTAAATATTCGCTTTGACTTGAATGCTACGATTAAGAGAGCGCAGA
TATAA