SecReT6
Protein ID: 209917405
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0214
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]241683..242165 [-]
Producthypothetical protein
NoteTssD
UniProt IDB6HZT1
KEGG IDecy:ECSE_0214
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-31, Aligned region: 6..145
Protein Sequence: 160 a.a.     [Download]
>gi|209917405|ref|YP_002291489.1| hypothetical protein ECSE_0214 [Escherichia coli SE11]
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELIITKPVDKSSP
LLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDI
SWEHTLAGTNAMSKWQDRVQ
 
Nucleotide Sequence: 483 bp     [Download]
>ref|NC_011415.1|:c242165-241683 hypothetical protein ECSE_0214 [Escherichia coli SE11]
ATGGCAAATATAAGTTATTTATCTTTGAGTGGAGAGACACAAGGGCTGATTTCAGCAGGTTGCTCAACGC
TTGATTCTGTCGGAAACAAAGCGCAGCCAGAACATAAAGATCAGATCATGGTTTATGCGTTAATGCATTC
CATCTCAAGAAGTCAAAATGTCAATCATCATGAATTAATTATCACCAAACCGGTTGATAAATCCTCACCA
TTGCTGGCAAAAGCACTTAGTGACAATGAAAAAATGGCAATATGTGAATTTATACTCTACCGAACCAGTA
AAGCGGGTATTTACCAGCCTTATTATAAAATAAATCTGTCAAAAGCCCGAATATCAAGTATTGATTTTGT
CACACCGCATGCTGTCCTGGAAAAAGAACTGGAACCACAGGAGAGAATTGCCTTTATTTATGAAGATATT
TCCTGGGAGCATACGTTAGCCGGTACGAATGCAATGAGTAAATGGCAGGATCGTGTACAGTAA