SecReT6
Protein ID: 209917410
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0219
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]249252..252215 [-]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDB6HZT6
KEGG IDecy:ECSE_0219
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 224..242
AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 710..871
AAA [PF00004], Evalue: 9.50E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 9.50E-17, Aligned region: 716..833
AAA [PF00004], Evalue: 9.50E-17, Aligned region: 845..907
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 715..835
ClpB_D2-small [PF10431], Evalue: 1.40E-12, Aligned region: 877..954
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 686..756
AAA_16 [PF13191], Evalue: 5.00E-11, Aligned region: 781..809
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 714..749
AAA_25 [PF13481], Evalue: 7.60E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 7.60E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 7.60E-05, Aligned region: 710..744
AAA_25 [PF13481], Evalue: 7.60E-05, Aligned region: 843..907
NACHT [PF05729], Evalue: 9.60E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 9.60E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 9.60E-05, Aligned region: 716..744
NACHT [PF05729], Evalue: 9.60E-05, Aligned region: 922..945
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 713..740
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 715..805
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 709..737
SAPS [PF04499], Evalue: 0.00034, Aligned region: 530..591
DUF258 [PF03193], Evalue: 0.00037, Aligned region: 199..239
DUF258 [PF03193], Evalue: 0.00037, Aligned region: 716..734
Nop14 [PF04147], Evalue: 0.0014, Aligned region: 514..637
BUD22 [PF09073], Evalue: 0.0017, Aligned region: 516..610
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 716..751
Daxx [PF03344], Evalue: 0.0064, Aligned region: 448..653
Protein Sequence: 987 a.a.     [Download]
>gi|209917410|ref|YP_002291494.1| ATP-dependent chaperone protein ClpB [Escherichia coli SE11]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLTMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDASDTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESESESESESESESESESESESESESESESESE
SESESESESESESESESESESESESESESESESEQDNTGAEPADEAGSEQPEETAETVSPVQRLAHLTAE
LDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLT
ARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGY
GEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIV
EHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAEVIIEPE
VTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVDGAFTADVEDAQNDESV
TKDETVL
 
Nucleotide Sequence: 2964 bp     [Download]
>ref|NC_011415.1|:c252215-249252 ATP-dependent chaperone protein ClpB [Escherichia coli SE11]
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGTCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTCATTCAGATGCTCAC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTGAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACAATGACGGACGCCTCTGACACCCTGCTTGCCCGCTATGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCAC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTC
AGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAG
TCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAG
AGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGCAGGATAATACCGGTGCCGAACCGGCTGATGAAGCTGG
CAGCGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAACGTCTGGCACATCTCACTGCCGAA
CTGGACGCCCTGCATAACGACCGGTTGCTGGTTTCCCCGCACGTCGATAAAAAACAGATTGCGGCGGTGA
TTGCCGAATGGACCGGCGTGCCGCTTAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGACCTGCC
AAAATGGCTCGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCACAAACACCTGCTGACC
GCACGCGCCGACCTGCGCCGTCCGGGACGCCCGCTGGGCGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGG
GTAAAACTGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAA
TATGTCCGAGTTCCAGGAGAAACATACCGTCTCGCGACTGATTGGCTCCCCTCCGGGCTACGTTGGCTAC
GGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCCTACTCGGTAGTACTGCTCGATGAAGTGG
AAAAAGCGCACCCGGATGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGGCGAAATGGCAGACGGTGA
AGGCCGCCTGATTGACTGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTCGGCTACCAGGTAATAGTC
GAGCATGCCGATGACCCGGAAACCATGCAGGAAGTACTGTATCCGGTGCTGGCCGACTTCTTCAAACCTG
CCCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCGCTGTCGAAAGAGACGCTCGCCACCATCATTGC
CGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGAGGTGATTATAGAACCGGAA
GTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTCATCG
ACGGCAATATGCTGCCGCCGCTCTCCCTGCTGCTGTTGCAGAAAATGGCGGCGAATACGGCGGTTGCCCG
GATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCTCAGAACGACGAGTCCGTC
ACAAAGGATGAAACGGTTTTATGA