SecReT6
Protein ID: 209917412
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0221
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]252990..254321 [-]
Producthypothetical protein
NoteTssK
UniProt IDB6HZT8
KEGG IDecy:ECSE_0221
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-147, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|209917412|ref|YP_002291496.1| hypothetical protein ECSE_0221 [Escherichia coli SE11]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
ARTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAA
NVPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>ref|NC_011415.1|:c254321-252990 hypothetical protein ECSE_0221 [Escherichia coli SE11]
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGCCCACACCATTTCCAGCAAC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATGATTTATCCTGGGGATTTAC
CGAACTCACCCTCAACAATGAACTGCTGGCGCAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAAAATTTTC
CGGACGAAAGAAGCCGCAATATCTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGACGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATTTGCATTCAGAAGAAGGTGAC
GCGCGAACATTGACGCTGGGTCAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGCGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGCGATCGCCATGCCGATGGCTCCCTGACGTTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGTATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCGCGCCCGCCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCTGGGTTGCTGGGTGAACTGATGACCTTTACCGAGCCGTCG
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGATCTGACCAAAACATTTAAAACACTGTTACCGG
AAGTCAAACGGGCGCTACATACCGTACTGTCGCCAAGAGCGGTCAATCTGCCGCTGCATCTGCGTGACGG
TATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTGTGCTGGCCGTGGCGGCA
AACGTGCCGGTCGATCAGATCCAGCGTCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATCCCCGGTATTCCATTGCGTGCCCTTATGGTGGCTCCCCGCCAGCTTCC
TTATCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGACAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA