SecReT6
Protein ID: 209917415
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0224
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]256150..257232 [-]
Producthypothetical protein
NoteTssG
UniProt IDB6HZU1
KEGG IDecy:ECSE_0224
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-93, Aligned region: 33..347
Protein Sequence: 360 a.a.     [Download]
>gi|209917415|ref|YP_002291499.1| hypothetical protein ECSE_0224 [Escherichia coli SE11]
MDGKNRAASSYLSPGNPSADKEQNEPLAQVFHNACSYNFFAMAELLHRLAQGEKGTPELSLRDDPTQETL
RFSADASLAFPLSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSH
RLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEII
CGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSI
TSLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTPEE
RPSVTIRVRS
 
Nucleotide Sequence: 1083 bp     [Download]
>ref|NC_011415.1|:c257232-256150 hypothetical protein ECSE_0224 [Escherichia coli SE11]
ATGGACGGAAAGAACCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCTCGGCAGATAAAGAGCAGA
ATGAGCCGCTGGCACAGGTTTTTCATAACGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCTGTTGCA
CCGCCTGGCACAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGCGACGATCCGACACAGGAAACCCTG
CGTTTCAGCGCCGATGCCAGCCTTGCGTTTCCCCTGAGTGATATCAGTGCGCTGAAACGGGATACGTCAG
GGGCATTCAGGATGACCACCACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTATTACCT
CGATCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTCAGCCAC
CGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACGGCGGTG
TGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAAGCTGGC
GATTAATCACAGCAAAATGCTGGCGTATTCCGGGATCCTGGCAAACCCGGGGCGATCCCCGGAAATTATC
TGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACGCTGCAAAACTGGCAGCGTCGCAAGGTGG
ATATTGAACCGGATCAGCAAAATAGTCTGGGGAGCTATTCACTTAAAAATGGCGAAAAACTGGCGGGAAG
ATCGGTACTGGGCAACTTTGTTCTGGGTACACGGGTGCCCGATCTCAGCGGAAAATTCCAGCTCAGTATT
ACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGACGATGT
TTGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCAGGTGGG
CGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCGGAAGAA
CGACCCTCAGTCACCATCAGGGTACGGTCGTAA