SecReT6
Protein ID: 209917416
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0225
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]257196..259046 [-]
Producthypothetical protein
NoteTssF
UniProt IDB6HZU2
KEGG IDecy:ECSE_0225
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-196, Aligned region: 5..616
Protein Sequence: 616 a.a.     [Download]
>gi|209917416|ref|YP_002291500.1| hypothetical protein ECSE_0225 [Escherichia coli SE11]
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLC
RDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGA
DLTVGEQHIRLPEFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEF
FTLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVV
SQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHRGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVIDGSLHWSLLS
AMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLH
PEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTESQETWKWTERTGQHPLI
 
Nucleotide Sequence: 1851 bp     [Download]
>ref|NC_011415.1|:c259046-257196 hypothetical protein ECSE_0225 [Escherichia coli SE11]
ATGGAATTTGAAGAACGCTATTTCCGGGAAGAACTCGATTACCTGCGCCAGCTCAGCAAGCTGCTGGCAA
CGGAAAAACCCCATCTGGCCCGCTTCCTGGCCGAAAAAGATGCGGATCCGGATATTGAACGCCTGCTGGA
AGGGGTGGCTTTTCTTACCGGCAATCTCCGCCAGAAAATTGAGGATGAATTCCCAGAACTGACGCACGGG
CTTATTAAGATGCTATGGCCTAATTACCTGCGTCCGGTTCCGGCAATGACCCTTATTGAATATACGCCGG
ATATGGATAAGTCTTCTGTACCGGTGTTAATCCCCCGTAATGAGCAGTTTACAACCAACGCCGGGGAAAT
CAGAGTTGATGAAGTGCTGCCCTCTGATGCTAAAAAGGAGGAGCCGCCTCCCTGTACCTTCACCCTCTGC
CGGGATATCTGGCTGCTGCCCGTTCGCCTGGAGCAGATTGAAAACCGCAGTACGACCCGTAATGGTGTTA
TCAACATCACCTTTTCGGTCGCACCGGGAACGGACTTCCGCACGCTGGATCTGAACAAACTTCGCTTCTG
GCTCGGCAATGACGACAACTATACCCGTGACCAGCTTTATTTATGGTTCTGCGAATACTTGCAGGGTGCC
GACCTGACTGTGGGTGAACAGCATATTCGCCTGCCTGAGTTTATGCTAAAAGCTGTCGGTTTTGAGCCGC
AGGATGCCATGCTGCCCTGGCCGAAAAACGTCCACAGCGGCTACCGGATCCTTCAGGAGTATTTCTGTTA
CCCCGATGCGTTTCTCTTTTTTGATCTTTGTGGTTGTCCGGCTTTGCCTGACGGATTGCAGGCGGAATTC
TTTACCCTGCAACTGCGTTTTTCGCGCCCTTTGCCCGTGGACATCCGGCTGCGCCGCGATTCCCTGCGCC
TGTATTGCGCACCTGCCATTAATTTATTTATCCACCATGCAGAAGCCATCACGCTGGACAACCGGCGGGC
AGACTATCCGCTGGTTCCCAGCCGCCATTACCCACAACATTACGATGTATTTTCCGTTAACAGTGTGGTG
AGCCAGGTCCAGGATATGTTCAGGAAAAAAGATCTGGGGCGTCCTGTTTCGACGCAGGCCGCGCGCCAGT
GGCCAGCCTTTGAAAGTTTCAGCCATCAGATGGAATACAGCCGGAAGCGGGAAGTGGTGTACTGGCATCA
CCGGACCAAAACATCCCTGTTCCATCGCGGCTTTGATCATACCCTTGCCTTTATACATGCTGATGGCAGT
TATCCGTCAGACGAATCTCTGCTCAGTAATGAAGTGGTTTCGGTATCGCTGACCTGTACCAACCGTGAGC
TTCCGTCACAAATTCGTTCCGGTGATATCACCGGCACAACCGGTAAAAATGCGGCTGTTGCTTCATTTCG
CAACATTACCCGCCCGACGCAACCACTCTGGCCGGTCATTGATGGCAGCCTGCACTGGTCCCTGCTCTCC
GCCATGAACCTGAATTATCTGTCATTACTGGATACGGACGCGCTGAAGCAGGTCATCGCCAACTTTGATC
GCCACGCAATCCATCATCCGCAGACGGCGCGGCTGTCACAACAAAAGCTGGATGCCATTGAGCGTCTGGA
GACCCGACCCGTTGATCGCCTGTTTACGGGTATTCCCGTTCGGGGGCTGGCCTCCACGCTGTATCTGCAC
CCGGAGCCGTTTGTCTGTGAAGGGGAAATGTATCTGCTCGGTACGGTGCTTTCGCATTTTCTGTCGCTGT
ACGCCAGCGTTAACTCATTCCACATGCTGACCGTTGTGAACACAGAAAGCCAGGAGACATGGAAATGGAC
GGAAAGAACCGGGCAGCATCCTCTTATCTGA