SecReT6
Protein ID: 209917417
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0226
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]259050..259463 [-]
Producthypothetical protein
NoteTssE
UniProt IDB6HZU3
KEGG IDecy:ECSE_0226
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-17, Aligned region: 30..118
Protein Sequence: 137 a.a.     [Download]
>gi|209917417|ref|YP_002291501.1| hypothetical protein ECSE_0226 [Escherichia coli SE11]
MIPDRERTTGSLFERMEASPARNWQGSSIHALRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSLAIAQCIERYEPRISHAEVQAVVSSATSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>ref|NC_011415.1|:c259463-259050 hypothetical protein ECSE_0226 [Escherichia coli SE11]
ATGATACCGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCACCGGCCAGAAACT
GGCAGGGAAGCAGTATTCATGCGCTCAGGCAGTCCATTCGCCAGAACCTGCGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAACTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCAATGAGTCTGGCCATCGCGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CTGTGGTTTCATCCGCCACCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACACATGAAGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTATCGGGTGGACTGA