SecReT6
Protein ID: 209917418
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0227
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]259470..260945 [-]
Producthypothetical protein
NoteTssC
UniProt IDB6HZU4
KEGG IDecy:ECSE_0227
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-188, Aligned region: 68..489
Protein Sequence: 491 a.a.     [Download]
>gi|209917418|ref|YP_002291502.1| hypothetical protein ECSE_0227 [Escherichia coli SE11]
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYHEDVSRNHEDYLWGNT
AWMLACNVADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAARVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDR
E
 
Nucleotide Sequence: 1476 bp     [Download]
>ref|NC_011415.1|:c260945-259470 hypothetical protein ECSE_0227 [Escherichia coli SE11]
ATGTCTTTACAGGAAGAGGAACTCGTTTCCAGTCATGCCGGGCAGCCTGAGCAGGCATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATAGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAGTCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACGAAGCAGGAACTTCTGGAAGACTTTGAATTTGCCCCAGAAATTATTCAGTCC
GGATTTTATAAACACGTTTATTCGTCCGGATTCGGACAGTTTGGTGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCACCTGACATGAAACTGCTGCAATACGTCAGTGCTGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACGGCACCCCGCTTCCTGCTTCGCCAGCCTTATTCACCAACAGATAA
CCCTGTTAAGAACTTTAACTATCACGAAGATGTCAGCCGGAATCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCGTGCAATGTCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAATATCATCGGTC
CGCAAAGCGGCGGTGCAGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGTCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTT
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGTAAAGACGCAGAAACCAACTATAAGTTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAGCAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAGAGG
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCGGACGTGCGCAGCCGCA
AGCCTCTGCGTGCTGCCAGAGTTGAGGTTATGGATGTGGAAGGCGAACCCGGCTGGTACCAGGTCGCGCT
GAGCGTGCGGCCCCATTTTAAATTTATGGGGGCAAACTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGG
GAGTAA