SecReT6
Protein ID: 209917419
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0228
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]260996..261220 [-]
Producthypothetical protein
NoteTssC
UniProt IDB6HZU5
KEGG IDecy:ECSE_0228
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|209917419|ref|YP_002291503.1| hypothetical protein ECSE_0228 [Escherichia coli SE11]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>ref|NC_011415.1|:c261220-260996 hypothetical protein ECSE_0228 [Escherichia coli SE11]
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA