SecReT6
Protein ID: 209917420
SecReT6 ID310
T6SS typei1
Gene symbol-
Locus tagECSE_0229
StrainEscherichia coli SE11
Repliconchromosome [GenBank: NC_011415] [Browse all T6SS(s) in this replicon]
Location [Strand]261255..261755 [-]
Producthypothetical protein
NoteTssB
UniProt IDB6HZU6
KEGG IDecy:ECSE_0229
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-55, Aligned region: 7..162
Protein Sequence: 166 a.a.     [Download]
>gi|209917420|ref|YP_002291504.1| hypothetical protein ECSE_0229 [Escherichia coli SE11]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGQVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>ref|NC_011415.1|:c261755-261255 hypothetical protein ECSE_0229 [Escherichia coli SE11]
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCCCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACGCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGCCAGGTGA
GCAATAAATAA