SecReT6
Protein ID: 21244829
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4112
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4818638..4819681 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8PF73
KEGG IDxac:XAC4112
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-21, Aligned region: 56..116
Protein Sequence: 347 a.a.     [Download]
>gi|21244829|ref|NP_644411.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MQDDSSLETLLAPLGDDAPAGPDLEYDPEFLRLERESAVRAERALGESVIAAEEPDWDKVQALALDLCRR
SRDLRVAGRLGAAWLRLRGLPGWADALALIHGLLERHWDSVHPQLDADDDNDPTSRINALVGLSDPMGLL
GALRATAFVQSPRLGRFSLRDLRVANGSIKLPDGQSGPSLAEIEACCQDCTPETLATSAQAITEALRQAR
AIDALLSERVGTAAPDLRPLLTDLRDLERFVLPHWQARQGISAIAEDGEQAAGEGHAVAMATNATCRNDE
IAGPDDVKRRLEEICAYYARHEPSSPVPMLLRRAQRLVGADFLALMKELAPAGIDELQRVTGPLEDS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4819681-4818638 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGCAAGACGACAGTTCCCTGGAGACCCTGCTGGCGCCGCTCGGCGACGACGCCCCGGCCGGACCGGATC
TGGAATACGACCCGGAGTTCCTGCGCCTGGAGCGCGAATCGGCGGTCCGCGCCGAGCGCGCGCTGGGCGA
GAGCGTCATCGCCGCCGAAGAACCGGACTGGGACAAGGTACAGGCGCTGGCGCTGGACCTGTGCCGGCGT
AGCCGCGACTTGCGCGTGGCCGGCAGGCTCGGCGCCGCCTGGCTGCGCCTGCGCGGCCTGCCGGGCTGGG
CCGACGCGCTGGCGTTGATCCATGGCCTGCTTGAGCGCCATTGGGACAGCGTGCATCCGCAACTGGATGC
CGACGACGACAACGACCCGACCTCGCGCATCAATGCGCTGGTCGGTCTTAGCGACCCGATGGGCCTGCTC
GGCGCGCTGCGCGCCACCGCGTTCGTGCAGTCGCCGCGGCTGGGCCGCTTCAGCCTGCGCGATCTACGCG
TGGCCAATGGCAGCATCAAGCTGCCCGACGGCCAGAGCGGCCCCAGCCTGGCCGAAATCGAAGCCTGCTG
CCAGGACTGCACGCCGGAAACGCTGGCCACCTCCGCCCAGGCCATTACCGAAGCGCTGCGGCAGGCGCGC
GCGATCGATGCGCTGCTGAGCGAACGTGTCGGCACCGCCGCCCCTGACTTGCGCCCGCTACTGACCGACC
TGCGCGATCTGGAGCGCTTCGTGCTGCCGCACTGGCAAGCGCGGCAGGGCATCTCGGCGATCGCCGAAGA
CGGCGAGCAGGCTGCCGGCGAAGGCCACGCCGTCGCCATGGCAACCAACGCCACGTGCCGCAACGACGAG
ATCGCCGGCCCCGATGATGTGAAGCGGCGGCTGGAAGAGATCTGCGCCTATTACGCCCGGCACGAACCGT
CCAGCCCGGTGCCGATGCTGCTGCGCCGCGCGCAACGCCTGGTCGGCGCCGATTTCCTGGCCCTGATGAA
GGAGCTGGCCCCGGCCGGCATCGACGAACTGCAACGCGTCACCGGCCCGCTGGAAGACAGCTAA