SecReT6
Protein ID: 21244837
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4120
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4837525..4838880 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ8PF65
KEGG IDxac:XAC4120
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.20E-69, Aligned region: 72..276
DUF2077 [PF09850], Evalue: 5.20E-69, Aligned region: 400..439
OmpA [PF00691], Evalue: 2.90E-11, Aligned region: 342..431
Protein Sequence: 451 a.a.     [Download]
>gi|21244837|ref|NP_644419.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MANAEDLRRYRIPLRQRIRRVGPAIVGDPELSMSRPVADLAPAYAAPLPAAGGTGVPSEDTDISELLGRS
VNPLVQAATPLLLLAVQLRHSAQSPDVARLREQVMAQVRRFEHRARDGGAPVEAVTAARYVLCALLDEAV
LNAPWGERSGWSQKTLLVTFHSESYGGAKFFQILERLCADMPRHLDLIELMYLCLALGFVGRYQIEAGGI
ATLAAIQEDVYRRIRAARGPAPDSLAPRWRGVEDRRRLGRYLPVWAAALLGLSLVVVAFVWLQARLNSLS
APISAQAAQWGIAPATPPDAAPVPPPPVRLKQLLSAQERAGLLRVDEQADGQTRVRLSSAAMFASGGVEV
ELQQRGLIAQIAAAIEQLPGRVIVVGHTDDVPVRSLRFQDNYALSAARAQALAQVLQAQLSTPGRVEAIG
AGASQPIAQPVQLPANRARNRRVEILFQPGE
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4838880-4837525 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGGCGAACGCTGAAGACCTCCGGCGGTATCGCATTCCACTTCGGCAGCGAATTCGCCGGGTTGGACCTG
CAATTGTGGGCGATCCGGAGCTGAGCATGAGCCGACCTGTTGCCGATCTGGCGCCAGCCTACGCCGCACC
GCTGCCGGCCGCAGGGGGCACCGGCGTGCCCAGCGAAGACACCGACATCAGCGAATTGCTGGGCCGCAGC
GTCAACCCGTTGGTGCAGGCCGCCACGCCGCTGCTGCTGTTGGCGGTGCAGTTGCGCCACAGTGCGCAAT
CGCCCGATGTGGCCCGCCTGCGCGAGCAGGTGATGGCGCAGGTGCGCCGCTTCGAACACCGTGCGCGCGA
TGGAGGCGCGCCGGTGGAAGCGGTCACCGCCGCGCGCTACGTGTTGTGCGCGCTGCTGGACGAAGCGGTG
CTCAACGCACCGTGGGGCGAGCGCAGCGGCTGGTCGCAGAAGACCTTGCTGGTGACCTTCCACAGCGAAT
CGTACGGCGGCGCCAAGTTCTTCCAGATCCTGGAGCGCTTGTGCGCCGATATGCCGCGGCATCTGGACTT
GATCGAGTTGATGTACCTGTGCCTGGCGCTGGGGTTCGTCGGCCGCTACCAGATCGAGGCCGGCGGCATC
GCGACGCTGGCGGCCATCCAGGAGGATGTCTATCGCCGCATCCGTGCGGCGCGCGGCCCCGCGCCGGACA
GCTTGGCGCCGCGTTGGCGCGGGGTGGAAGACCGCCGCCGGCTGGGCCGTTATCTGCCGGTGTGGGCGGC
TGCATTGCTGGGGTTGAGCCTGGTGGTGGTGGCGTTCGTGTGGTTGCAGGCGCGTTTGAACAGCCTGTCC
GCACCGATCAGTGCGCAGGCCGCCCAATGGGGAATTGCGCCGGCCACGCCGCCGGACGCTGCACCCGTGC
CGCCGCCTCCGGTGCGGCTCAAGCAGTTGCTCTCCGCGCAGGAACGCGCCGGCCTGCTGCGCGTGGACGA
ACAGGCCGACGGGCAGACGCGCGTGCGCCTCAGCAGCGCGGCGATGTTCGCCTCCGGCGGGGTGGAGGTG
GAGCTGCAGCAGCGCGGCTTGATCGCGCAGATTGCAGCGGCCATCGAGCAATTGCCGGGGCGGGTGATCG
TGGTCGGGCACACCGATGACGTGCCGGTGCGCTCGCTGCGCTTCCAGGACAACTACGCCTTGTCGGCCGC
GCGTGCGCAGGCGCTTGCGCAGGTGTTGCAGGCGCAGCTGAGCACGCCGGGGCGGGTGGAAGCCATTGGC
GCCGGCGCTTCGCAACCGATCGCACAGCCGGTGCAATTACCGGCCAACCGCGCGCGCAACCGCCGCGTGG
AGATCTTGTTCCAGCCTGGGGAATGA