SecReT6
Protein ID: 21244838
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4121
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4838787..4840121 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ8PF64
KEGG IDxac:XAC4121
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-153, Aligned region: 18..443
Protein Sequence: 444 a.a.     [Download]
>gi|21244838|ref|NP_644420.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MQNNKVVWSEGLFLRPQHLQQQERYLERYVDLRAARLRPHAWGVSELEWESDLLAVGKLGLRRARGVFAD
GTPFAMPGDDPLPVALEVEPNCRDQIVYLTVPLRVPAQPELGRPESPADQLFRYRVRETESNDASGSTSE
AVLMEVGGLSTRLLPHSQPLEGLDRIAVARIIEMRADRQVVLDPHFIPSAMVCQAAPRLTTFLTELLGLL
HQRGEALASRVTLTDRGGAADIADFLLLQLVNRWQPQMAHWAAAPLAHPEELFRALVALAGELSTFTAAG
KRPPAWPAYRHQSQQDSFEPVIGALRSSLSAVLEQTATPLPIQARKFGVWVAMVPDPGLLDSAAFVLAAK
ADMPSEELRRQLPAHAKIGPVEQIRDLVNLQLPGIVATPMPVAPRQIPYHAGYLYFEFDKSAALWRTLKT
SGGIAFHFGSEFAGLDLQLWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4840121-4838787 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGCAGAACAACAAGGTCGTGTGGAGCGAAGGGCTGTTCCTGCGCCCGCAGCATCTGCAGCAGCAAGAGC
GCTACCTGGAGCGCTACGTCGATCTGCGTGCCGCGCGATTGCGGCCGCATGCCTGGGGCGTGAGCGAGCT
GGAATGGGAGAGCGACCTGCTGGCGGTGGGCAAGCTGGGCCTGCGGCGCGCGCGTGGCGTGTTCGCCGAT
GGCACGCCCTTCGCGATGCCGGGCGACGACCCGCTGCCGGTTGCGCTGGAGGTCGAGCCCAACTGCCGCG
ACCAGATCGTCTATCTCACCGTACCGCTGCGGGTGCCGGCGCAGCCCGAACTCGGGCGCCCGGAATCGCC
GGCCGATCAGCTGTTTCGCTACCGCGTGCGCGAGACCGAAAGCAACGACGCCTCCGGCAGCACCAGCGAA
GCGGTGTTGATGGAAGTCGGCGGGTTGAGCACGCGGTTGCTGCCGCACTCGCAACCGTTGGAGGGGCTGG
ACCGCATCGCGGTGGCGCGCATCATCGAGATGCGCGCCGACCGTCAGGTGGTGCTGGACCCGCATTTCAT
TCCCAGCGCGATGGTATGCCAGGCGGCGCCGCGCTTGACCACCTTTCTGACCGAGTTGCTCGGTCTGTTG
CATCAGCGCGGCGAAGCGCTGGCATCGCGCGTGACGCTGACCGATCGCGGCGGTGCGGCCGATATCGCAG
ACTTTCTGCTGCTGCAGCTGGTCAACCGTTGGCAGCCGCAGATGGCGCACTGGGCGGCCGCGCCATTGGC
GCATCCGGAAGAGTTGTTTCGCGCCTTGGTGGCGCTGGCCGGTGAACTGAGCACGTTCACCGCTGCCGGC
AAGCGCCCGCCTGCATGGCCTGCCTATCGGCACCAATCGCAGCAGGACAGCTTCGAGCCGGTGATCGGCG
CCTTGCGCAGCAGTTTGAGCGCAGTGCTCGAACAGACCGCCACGCCGCTCCCGATCCAGGCGCGCAAGTT
CGGCGTGTGGGTGGCGATGGTGCCGGACCCGGGCCTGCTCGACAGCGCGGCGTTCGTGCTCGCGGCCAAG
GCCGACATGCCCAGCGAAGAGTTGCGCCGGCAATTGCCCGCGCACGCCAAGATCGGGCCGGTGGAGCAGA
TTCGCGATCTGGTCAATCTGCAGTTGCCCGGCATCGTGGCCACGCCCATGCCGGTGGCGCCGCGACAGAT
TCCGTATCACGCCGGCTATCTGTATTTCGAATTCGACAAGAGCGCAGCGTTGTGGCGAACGCTGAAGACC
TCCGGCGGTATCGCATTCCACTTCGGCAGCGAATTCGCCGGGTTGGACCTGCAATTGTGGGCGATCCGGA
GCTGA