SecReT6
Protein ID: 21244839
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4122
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4840701..4842017 [-]
Producthypothetical protein
NoteFha
UniProt IDQ8PF63
KEGG IDxac:XAC4122
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-15, Aligned region: 32..95
Protein Sequence: 438 a.a.     [Download]
>gi|21244839|ref|NP_644421.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MSSSQLILTVGGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNGMYFIEDRSTN
GMSLNGTALTRADPSALSDGDRLQLDSFEIHVQVQSLAAAPTPAPAFDPLPDAMDDRTQVAPPPSTRRAP
SATACLDLLEFGTPPSARPAVDALLDDLLLSGAPGELDPLRLLDPSPAPARDASPSAWNQSNASHDHFRP
PASPDARATLPENWDMTLGDFAPPAPLPALAPMAAPVASPFAPPAAVSVATAPSAATTVPPELDRIFAIV
VDGVMDVLRARAEIKNTFRLPVTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRC
HQMAMLAGMRAAFDAMLFHFSPDRLEQEADAGGKRLGFGGKGRYWERYRDNFEQLRSDPDDCFRRLFGDE
FARAYEAQLARLKSARRH
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4842017-4840701 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGTCCAGTTCGCAGTTGATCCTCACCGTCGGCGGCGCGCAGGCCGCGCAGTTCGGCGCCAGCGCGCAGA
AGCGCTTTGCCGGCACCGGCGGCAGCATCGGCCGCTCCGACGAAAGCGATTGGGTCCTGGCCGCGCCCGG
TGTCTCGCGCACGCATGCGGTGGTGCGCTTTCTCAACGGGATGTATTTCATCGAGGACCGCAGCACCAAC
GGCATGTCGCTCAACGGCACTGCGCTGACGCGTGCGGACCCGTCCGCGCTCAGCGATGGCGACCGCCTGC
AGCTGGACAGCTTCGAGATCCATGTGCAGGTGCAATCGCTGGCTGCAGCCCCGACGCCGGCGCCGGCATT
CGACCCGCTGCCAGATGCGATGGACGACCGCACCCAGGTTGCGCCGCCGCCGTCGACGCGGCGTGCCCCC
TCCGCCACAGCGTGCCTGGATCTGCTGGAGTTCGGTACGCCGCCTTCTGCGCGGCCTGCAGTGGACGCGT
TGTTGGACGATCTGCTGCTGAGCGGCGCACCCGGCGAGCTGGATCCGTTGCGCCTGCTCGACCCGTCGCC
TGCACCGGCACGCGATGCCAGCCCCAGCGCGTGGAATCAGAGCAACGCCAGCCACGACCATTTCCGTCCA
CCGGCCAGTCCCGATGCGCGCGCCACCTTGCCGGAAAACTGGGACATGACGCTTGGCGATTTTGCGCCGC
CCGCGCCATTGCCTGCGTTAGCGCCCATGGCCGCGCCGGTGGCCTCGCCATTCGCGCCGCCGGCGGCGGT
GTCGGTTGCAACCGCACCATCGGCGGCAACAACAGTGCCGCCGGAGCTGGATCGCATCTTCGCCATCGTG
GTCGATGGCGTCATGGATGTGCTGCGTGCACGCGCAGAGATCAAGAACACCTTTCGCTTGCCGGTCACGG
TGATCCAACGCTCGGAGAACAACCCGCTCAAGTTCGCCGCCACCGCCGAAGATGCGCTGCAGAAGTTGCT
CGCACCGCCAAGCGCGTCGTTTCTGTCCGGGGTGCCAGCGTTCGAAGATGCCTTCGACGATATCCGCTGC
CATCAGATGGCGATGCTGGCCGGCATGCGCGCGGCCTTCGACGCCATGCTGTTCCACTTCAGCCCGGACC
GCCTGGAGCAGGAAGCCGACGCCGGCGGTAAGCGCCTGGGTTTCGGTGGCAAGGGGCGTTACTGGGAACG
CTACCGCGACAATTTCGAGCAGCTGCGCAGCGACCCGGACGACTGCTTCCGTCGCCTGTTCGGCGATGAG
TTCGCGCGTGCCTACGAGGCGCAACTGGCGCGCTTGAAATCGGCACGGCGGCATTGA