SecReT6
Protein ID: 21244841
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4124
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4842849..4844885 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ8PF61
KEGG IDxac:XAC4124
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-70, Aligned region: 47..352
Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 73..87
Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 390..482
Protein Sequence: 678 a.a.     [Download]
>gi|21244841|ref|NP_644423.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MRVRNTAPSVSATCVAPSPVDASMPRTIMLHSDLGERLLLHRMQASEALGQLFDYRIDALCTELQPNLRD
LLGTPVAVQLADGEGEQRWYHGMVASCAHNGYAVVDALEYAVLELQVVPKPWLLTQRRDCRIYQDMSVPE
IVTSVLGEIGYGDVQQQLSAQYAKRTYCVQYREDDFSFISRLLEREGIYYYFTHSRSAHTLVLADALGAH
AAQNGVDSLPYAPPGTDDRRLMRSVVSHWRSARGVHSSQHGSTDYDPLQPRASLAAEADASGEQLHTVDG
LIAFDYPGAHTVQTDGNRYMQVRSEAHNVQRASHAATTNACGLMVGALFRLRGFPRAELNQEYLVLSAHT
TLAAPEHASGEPPFSSSVQVMESRLPFRSLQRTVTPTIAGLQTAVVTGDTDEDIAVDAHGRVQVTFHWAT
AARPHAALSCWVRVASMWAGKGWGAMSLPRVGQEVVVSFLEGDPDRPLIVGSVYNGDHAPPFSLPDNKTQ
SGVRSRSLLGGTADFNELRFEDKAGAEELYLRAQRDLREEVQHDHTSTIDNDRVLTVKHDRSARIDNNDS
VDVGKKLLLKAGEEIELVTGSARLVMKQNGEIVLSGIKILVDASSEAKITSTAIKLLADAQLQAKSPATE
VAGDATLKLTSGGMLSAEAGASATLKGPLVSIKADALVQVGGGLIMIG
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4844885-4842849 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGCGGGTACGCAACACAGCGCCGTCGGTCAGCGCAACGTGCGTTGCCCCATCACCTGTGGATGCTTCGA
TGCCGCGCACCATCATGCTGCACTCCGACCTTGGCGAGCGCCTGCTGCTGCACCGCATGCAGGCCAGCGA
AGCGTTGGGGCAGCTGTTCGACTACCGCATCGATGCGTTGTGCACCGAGCTGCAGCCCAACCTGCGTGAT
CTGCTTGGCACGCCAGTGGCGGTGCAACTGGCCGATGGCGAGGGCGAACAGCGCTGGTATCACGGCATGG
TGGCCAGTTGCGCGCACAACGGCTACGCCGTGGTCGATGCGCTCGAGTACGCCGTGCTGGAACTGCAGGT
GGTGCCCAAACCATGGCTGCTGACACAGCGCCGCGATTGCCGTATCTATCAGGACATGAGCGTGCCGGAG
ATCGTCACCAGCGTGCTGGGCGAGATCGGCTACGGCGATGTGCAGCAGCAGTTGAGCGCGCAGTACGCCA
AGCGCACCTACTGCGTGCAATACCGCGAGGACGATTTCAGCTTCATCAGCCGGCTGCTGGAACGCGAAGG
CATCTACTACTACTTCACCCATAGCCGCAGTGCGCATACCTTGGTGCTGGCCGATGCGCTGGGTGCGCAT
GCAGCGCAAAATGGCGTGGACAGCTTGCCGTATGCGCCGCCGGGCACCGACGACCGGCGCCTGATGCGCT
CGGTGGTGAGCCATTGGCGCAGTGCGCGCGGCGTACATTCCAGCCAGCATGGCAGCACCGACTACGACCC
GCTGCAGCCGCGTGCATCGCTGGCCGCCGAGGCCGACGCCAGCGGCGAACAGTTGCACACCGTCGATGGT
CTGATCGCCTTCGACTATCCCGGTGCGCATACAGTGCAAACCGACGGTAATCGCTACATGCAGGTGCGCA
GCGAGGCGCACAACGTGCAGCGCGCCAGCCATGCAGCCACCACCAATGCCTGCGGCCTGATGGTCGGTGC
CTTGTTTCGCTTGCGCGGGTTTCCGCGTGCCGAACTCAATCAGGAATATCTGGTGCTGTCGGCGCACACC
ACGCTGGCCGCGCCCGAACACGCTAGCGGCGAGCCGCCGTTTTCCAGCAGCGTGCAGGTGATGGAAAGCC
GGCTGCCGTTCCGTAGCCTGCAACGCACCGTAACGCCGACCATTGCCGGCCTGCAGACGGCGGTGGTGAC
CGGCGACACCGACGAGGACATTGCGGTGGATGCGCATGGCCGCGTGCAGGTGACCTTTCACTGGGCCACT
GCGGCACGCCCGCATGCCGCACTGTCGTGCTGGGTGCGTGTGGCCTCGATGTGGGCGGGCAAGGGCTGGG
GCGCGATGAGCCTGCCACGCGTGGGGCAGGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCGCCC
GCTGATCGTGGGCAGCGTCTACAACGGCGACCATGCGCCGCCGTTTTCCTTGCCCGACAACAAGACCCAA
AGCGGCGTGCGCAGCCGCAGCCTGCTGGGCGGCACTGCCGATTTCAACGAGCTGCGATTCGAAGACAAGG
CCGGCGCAGAAGAGCTCTACCTGCGTGCGCAACGCGATCTGCGCGAAGAAGTGCAGCACGATCACACCAG
CACCATCGACAACGATCGGGTGCTGACCGTCAAGCACGACCGCAGCGCGCGTATCGACAATAACGACAGC
GTGGATGTCGGCAAGAAGCTGCTGCTGAAAGCCGGCGAAGAGATCGAGTTGGTGACCGGCAGCGCGCGCC
TGGTGATGAAGCAGAACGGCGAGATCGTGTTGAGCGGCATCAAGATCCTGGTCGATGCCAGCTCGGAAGC
CAAGATCACCTCCACCGCCATCAAGCTCCTTGCCGATGCACAGCTGCAGGCCAAATCGCCGGCCACCGAA
GTGGCTGGCGATGCCACGCTTAAACTGACCTCCGGCGGCATGCTCAGTGCCGAAGCCGGTGCCTCGGCCA
CGCTCAAGGGTCCTTTGGTCAGCATCAAGGCCGACGCCTTGGTGCAGGTCGGCGGCGGCCTGATCATGAT
CGGATGA