SecReT6
Protein ID: 21244843
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4126
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4846534..4846929 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ8PF59
KEGG IDxac:XAC4126
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.40E-21, Aligned region: 38..52
PAAR_motif [PF05488], Evalue: 3.40E-21, Aligned region: 54..122
DUF4150 [PF13665], Evalue: 1.50E-05, Aligned region: 37..47
DUF4150 [PF13665], Evalue: 1.50E-05, Aligned region: 67..85
DUF4150 [PF13665], Evalue: 1.50E-05, Aligned region: 92..117
Protein Sequence: 131 a.a.     [Download]
>gi|21244843|ref|NP_644425.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MRQRPLPRWRSAETNCRVTGAAWLDSAVHGHDRSVPMQPAARLTDLHVCPMVTGVVPHVGGPIVSPCAPT
VLIGGLPAARLGDMAVCVGPPDSIVAGAPTVLIAGQPAARLGDSTAHGGVITLGCFTVLIG
 
Nucleotide Sequence: 396 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4846929-4846534 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGAGGCAGAGGCCACTACCGCGGTGGCGCAGCGCTGAGACGAATTGTCGGGTGACCGGCGCGGCCTGGC
TGGATAGTGCCGTGCATGGCCACGACCGAAGCGTGCCGATGCAACCCGCCGCGCGCCTGACCGATTTGCA
TGTCTGCCCCATGGTGACCGGGGTGGTGCCGCATGTGGGCGGGCCGATCGTCAGCCCCTGTGCGCCAACG
GTATTGATCGGCGGCCTGCCGGCGGCGCGGCTGGGCGACATGGCGGTATGCGTCGGCCCGCCGGACAGCA
TCGTGGCCGGCGCACCGACCGTGTTGATCGCAGGCCAGCCTGCTGCGCGCCTGGGCGACAGTACCGCACA
TGGCGGGGTGATCACCTTGGGCTGCTTCACCGTGCTGATCGGGTGA