SecReT6
Protein ID: 21244857
SecReT6 ID28
T6SS typei3
Gene symbolclpB
Locus tagXAC4140
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4865531..4868311 [-]
Productchaperone ClpB
NoteTssH
UniProt IDQ8PF46
KEGG IDxac:XAC4140
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 236..256
AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 646..812
AAA [PF00004], Evalue: 4.10E-18, Aligned region: 130..153
AAA [PF00004], Evalue: 4.10E-18, Aligned region: 236..348
AAA [PF00004], Evalue: 4.10E-18, Aligned region: 652..736
ClpB_D2-small [PF10431], Evalue: 7.00E-14, Aligned region: 819..890
AAA_5 [PF07728], Evalue: 4.70E-12, Aligned region: 236..256
AAA_5 [PF07728], Evalue: 4.70E-12, Aligned region: 371..403
AAA_5 [PF07728], Evalue: 4.70E-12, Aligned region: 651..769
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 40..77
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 123..162
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 213..258
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 280..314
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 498..498
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 622..694
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 716..737
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 214..259
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 650..764
AAA_22 [PF13401], Evalue: 7.90E-06, Aligned region: 235..316
AAA_22 [PF13401], Evalue: 7.90E-06, Aligned region: 365..402
AAA_22 [PF13401], Evalue: 7.90E-06, Aligned region: 649..674
AAA_22 [PF13401], Evalue: 7.90E-06, Aligned region: 713..735
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 235..258
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 650..691
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 823..857
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 233..260
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 649..673
AAA_14 [PF13173], Evalue: 5.60E-05, Aligned region: 236..304
AAA_14 [PF13173], Evalue: 5.60E-05, Aligned region: 342..402
AAA_14 [PF13173], Evalue: 5.60E-05, Aligned region: 650..761
AAA_17 [PF13207], Evalue: 7.90E-05, Aligned region: 236..260
AAA_17 [PF13207], Evalue: 7.90E-05, Aligned region: 494..557
AAA_17 [PF13207], Evalue: 7.90E-05, Aligned region: 651..689
AAA_17 [PF13207], Evalue: 7.90E-05, Aligned region: 839..858
AAA_25 [PF13481], Evalue: 8.30E-05, Aligned region: 231..312
AAA_25 [PF13481], Evalue: 8.30E-05, Aligned region: 362..406
AAA_25 [PF13481], Evalue: 8.30E-05, Aligned region: 649..676
NACHT [PF05729], Evalue: 0.00014, Aligned region: 236..263
NACHT [PF05729], Evalue: 0.00014, Aligned region: 651..678
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 214..256
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 287..385
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 650..692
Arch_ATPase [PF01637], Evalue: 0.00065, Aligned region: 717..733
AAA_18 [PF13238], Evalue: 0.00097, Aligned region: 236..259
AAA_18 [PF13238], Evalue: 0.00097, Aligned region: 652..682
IstB_IS21 [PF01695], Evalue: 0.0014, Aligned region: 229..257
IstB_IS21 [PF01695], Evalue: 0.0014, Aligned region: 651..670
AAA_29 [PF13555], Evalue: 0.0063, Aligned region: 228..251
AAA_29 [PF13555], Evalue: 0.0063, Aligned region: 649..676
DUF815 [PF05673], Evalue: 0.0075, Aligned region: 226..311
DUF815 [PF05673], Evalue: 0.0075, Aligned region: 650..689
Protein Sequence: 926 a.a.     [Download]
>gi|21244857|ref|NP_644439.1| clpB gene product [Xanthomonas axonopodis pv. citri str. 306]
MAEISRSSLFGKLNPLAYRGIESATVFCKLRGNPYVELVHWLHQLLQLQDSDLHRIIRHFQLNPSTLARD
VTAALDGLPRGSTAVTDLSANVEEAVERGWVYASLGFGEAQVRTGYLVVGMLSVRGLRHALLAISKEFDK
LKPAVLNERFAEIVAGSPEDGLLPSDGFSLGQAAAPGETSGAIAPAALGKQEALKKFTTDLTAQAREGKL
DPIIGRDDEIRQVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALKDVQLRALDVGLLQA
GASMKGEFEQRLRAVIDEVQASPKPIILFVDETHTLIGAGGAAGTGDAANLLKPALARGTLRTVGATTFA
EYKKYIEKDPALTRRFQAVQVDEPDESKAVRMMRGVASMMEQHHRVQILDEALEAAVKLSHRYIPARQLP
DKSVSLLDTACARVAVSLHATPAEVDDSRRRIESLDTEQAIIERERAIGIVVEERAAACAGLLESEHGRL
QALEQRWVAEKALVDELLSLRAQLRSDNAPVEGTGSALEAEADTAQAASGDIAVLDAPVQVDRDTLLARL
QLVQAGLGALQGESPLILPTVDHQAVAAVVADWTGIPVGRMARDEIDTVLRLPELLAKRVIGQDHAMEMI
AKRIQTSRAGLDNPDKPIGVFLLAGTSGVGKTETALALAETLYGGEQNLITINMSEYQEAHTVSSLKGAP
PGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHELFFQVFDKGWMEDGEGRRIDFRNTLIILTSNA
GTDLIASLCKDPDLMPDPEGMAKAIREPLLKVFPPALLGRLVAIPYYPLSNAMLGQIVRLQLNRIKTRIE
ERYKIPFDYDDSVVELVISRCTESESGGRMIDAILTNSVLPEISREFLERVNSGDPVLRIELGACDRSFV
YDFLKNRHQETKNGNL
 
Nucleotide Sequence: 2781 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4868311-4865531 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGGCCGAGATCTCCCGCAGCTCCCTGTTCGGCAAGCTCAATCCGCTGGCCTACCGCGGCATCGAAAGCG
CCACCGTGTTCTGCAAGCTGCGCGGCAACCCGTATGTGGAATTGGTGCATTGGCTGCATCAGTTGCTGCA
GCTGCAGGACTCGGACCTGCACCGCATCATCAGGCACTTTCAGCTCAACCCGTCCACGCTTGCGCGCGAT
GTCACCGCCGCGCTGGATGGCTTGCCGCGCGGCTCCACTGCCGTGACCGATCTATCGGCCAATGTCGAAG
AAGCGGTGGAGCGCGGTTGGGTGTACGCCTCACTCGGTTTTGGTGAAGCGCAAGTACGCACCGGCTATCT
GGTGGTCGGTATGTTGAGCGTGCGTGGCTTGCGTCATGCGTTGCTGGCGATCTCCAAGGAGTTCGACAAG
CTCAAGCCCGCAGTGCTCAACGAGCGCTTCGCCGAGATCGTGGCCGGCTCGCCGGAAGATGGCTTGCTGC
CCAGCGATGGATTTTCGCTTGGTCAGGCCGCTGCACCCGGGGAGACCAGCGGTGCCATCGCGCCTGCCGC
ACTCGGCAAGCAGGAAGCGCTGAAGAAATTCACCACCGACCTCACCGCCCAGGCGCGCGAAGGCAAGCTG
GACCCGATCATCGGCCGCGACGACGAGATCCGCCAGGTGGTCGACATCCTGATGCGCCGCCGCCAGAACA
ACCCGATCCTGGTCGGCGAAGCCGGCGTCGGCAAGACCGCGGTGGTGGAAGGGTTCGCGCAGCGCATCGC
GCGCGGCGACGTGCCGCCGGCGTTGAAGGATGTGCAACTGCGCGCGCTGGATGTCGGCTTGCTGCAGGCC
GGCGCCAGCATGAAGGGCGAGTTCGAACAGCGTCTGCGCGCGGTGATCGACGAGGTGCAGGCCAGCCCCA
AGCCGATCATTTTGTTCGTCGACGAAACCCACACCCTCATCGGCGCCGGTGGTGCCGCAGGCACCGGCGA
TGCGGCGAACCTGCTCAAGCCGGCACTGGCGCGCGGCACGCTGCGCACGGTGGGCGCGACCACGTTTGCC
GAATACAAGAAATACATCGAAAAGGACCCCGCGCTGACGCGGCGCTTCCAGGCCGTGCAGGTGGACGAAC
CGGACGAGTCCAAGGCCGTGCGCATGATGCGCGGCGTCGCTTCGATGATGGAACAGCATCACCGCGTGCA
GATCCTCGACGAAGCGCTGGAAGCGGCGGTCAAGCTCAGCCACCGCTACATCCCTGCGCGGCAGCTGCCG
GACAAGTCGGTGAGCCTGCTGGACACGGCCTGCGCGCGCGTGGCGGTGAGCCTGCATGCCACGCCTGCGG
AAGTGGACGACAGCCGCCGACGCATCGAATCGCTGGACACCGAGCAGGCGATCATCGAGCGCGAGCGTGC
GATCGGCATCGTGGTGGAGGAGCGTGCCGCTGCGTGTGCTGGCCTGCTGGAAAGCGAGCACGGCCGCCTG
CAGGCGTTGGAACAGCGTTGGGTTGCAGAAAAGGCATTGGTCGACGAGCTGTTGTCGCTGCGCGCGCAAT
TGCGCAGTGACAATGCGCCCGTAGAAGGCACTGGCAGCGCACTGGAAGCAGAGGCCGATACCGCGCAGGC
AGCGTCTGGCGACATCGCCGTGCTCGACGCACCGGTGCAGGTTGATCGCGACACGCTGCTGGCGCGCCTG
CAATTGGTGCAGGCGGGACTAGGCGCGCTCCAAGGCGAATCGCCTCTGATCCTGCCCACTGTCGATCATC
AGGCCGTTGCTGCCGTCGTCGCCGACTGGACCGGCATCCCGGTCGGGCGCATGGCGCGCGACGAGATCGA
CACCGTGCTGCGCCTGCCCGAACTGCTGGCCAAGCGCGTGATCGGCCAGGATCACGCCATGGAGATGATC
GCCAAGCGCATCCAGACCAGCCGCGCCGGCCTGGACAACCCGGACAAACCGATCGGCGTGTTCCTGCTGG
CCGGCACCTCCGGCGTGGGCAAGACCGAAACCGCGCTCGCCTTGGCCGAAACGCTGTACGGCGGCGAACA
GAACCTGATCACCATCAACATGAGCGAGTACCAGGAGGCGCACACCGTCTCCTCGCTCAAGGGCGCACCA
CCGGGCTACGTGGGCTACGGCGAAGGCGGCGTGCTGACCGAAGCGGTGCGACGCAAGCCGTACTCAGTGG
TGCTGCTGGATGAAGTGGAGAAGGCCCACCCGGACGTCCACGAACTGTTCTTCCAGGTCTTCGACAAGGG
CTGGATGGAAGACGGCGAAGGCCGCCGCATCGACTTCCGCAACACCCTCATCATCCTCACCAGCAACGCC
GGCACCGACCTGATCGCCAGCCTGTGCAAGGACCCGGACCTGATGCCCGACCCGGAAGGCATGGCCAAGG
CCATCCGCGAGCCGTTGTTGAAGGTGTTTCCGCCGGCATTGCTCGGACGGCTGGTCGCGATTCCGTATTA
CCCGCTCAGTAACGCCATGCTCGGACAGATCGTGCGACTGCAGTTGAACCGCATCAAGACGCGCATCGAA
GAGCGCTACAAGATTCCATTCGACTACGACGACTCGGTGGTGGAGCTAGTGATCTCGCGATGCACCGAGA
GTGAATCGGGCGGACGGATGATCGATGCGATTTTGACTAACTCGGTGTTGCCGGAGATCAGTCGGGAGTT
TCTGGAACGCGTGAATAGTGGTGATCCGGTTTTGCGGATCGAACTGGGTGCTTGCGACAGAAGCTTCGTT
TACGACTTCCTAAAAAATAGGCATCAGGAGACTAAGAATGGCAACCTATGA