SecReT6
Protein ID: 21244859
SecReT6 ID28
T6SS typei3
Gene symbol-
Locus tagXAC4142
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4869371..4871254 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ8PF44
KEGG IDxac:XAC4142
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-221, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|21244859|ref|NP_644441.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MDPRLLPYYTRELQHVRDMGAEFAREYPKIAGRLGLDAFECADPYVERLLEGFAFLAARVQLKLDAQYPV
FTQHLLEMVYPHYLAPLPSMAVVQLQPDLKDSGLAAGVVVSRQSALRSLVGPGERTACEFRTAHPVTLWP
LQLAEAKYLESPAALAAAGIALPPGRVVRAGVRLRFELVGGAQTHALALDRLPLFLAGADGLPKRLYEQL
HADTTAVVVRGSDARGGTLEVTLDADAVQMRGFADDDALIPYDGRSFSGYRLLQEYFACPERFLFAELAG
LRAPLRRLHGSSFEVVVLLQRSLPSLAAAVDAEHFKLFCTPAINLFPRRADRIHLQAGLHEYHVLADRTR
PMDFEIHHLGEVEGFGDRQEPEQCFTAFYGGDARTWHARHGAFYSMRREPRMLSARQRRDGARSSYVGSE
VFVSLVDADDQAHSTRLRQLGLQLWCSNRDLPLHMPVGKGASDFTMDSGVPVRSVRCVAGPTKPRPALSD
GQTAWRLLSQLQLNYLSLFEDGPDGAAALREILALYCDPFDASAQRQIEGVKQVSGTPIVRRIPVPGPIT
FGRGLEITLTCEDAAFEGTGAFLLASVLRHFFARYVSVNSFTETVLRTTERNEVARWPAQPGTRPRL
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4871254-4869371 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGGACCCGCGCCTACTGCCGTACTACACCCGCGAGTTGCAGCACGTGCGCGACATGGGCGCGGAGTTTG
CGCGCGAGTATCCCAAGATCGCCGGCCGGCTTGGCCTGGACGCGTTCGAATGCGCCGACCCCTATGTCGA
GCGGCTGCTGGAAGGCTTCGCGTTTCTGGCCGCGCGCGTGCAACTCAAGCTGGACGCGCAGTACCCGGTG
TTCACCCAGCACCTGCTGGAGATGGTCTACCCGCATTATCTGGCGCCGCTGCCGTCGATGGCGGTGGTGC
AGTTGCAGCCGGATCTGAAAGACAGCGGGCTGGCAGCAGGCGTCGTCGTGTCGCGGCAAAGCGCGCTGCG
CAGCCTGGTCGGCCCCGGCGAGCGCACCGCCTGCGAATTCCGCACCGCGCATCCGGTGACCTTGTGGCCG
TTGCAACTGGCCGAGGCCAAGTATCTGGAATCGCCAGCCGCCTTGGCCGCTGCCGGCATCGCTTTGCCGC
CCGGGCGCGTGGTGCGTGCCGGCGTGCGGCTGCGCTTCGAGCTGGTGGGTGGTGCGCAGACGCACGCGCT
GGCGCTGGATCGGCTGCCGCTGTTTCTGGCCGGCGCCGACGGCCTGCCCAAGCGGTTGTACGAACAACTG
CATGCCGATACCACCGCCGTGGTGGTGCGTGGCAGCGATGCCCGCGGTGGCACGCTGGAGGTGACGCTGG
ACGCCGATGCCGTGCAGATGCGCGGCTTTGCCGACGACGATGCATTGATTCCGTACGACGGCCGTTCGTT
CAGTGGCTATCGCCTGCTGCAGGAGTATTTCGCCTGCCCGGAGCGCTTTTTGTTCGCAGAGCTCGCCGGG
CTGCGCGCGCCATTGCGGCGGTTGCACGGCAGCAGCTTCGAGGTGGTGGTGTTGCTGCAACGCAGCCTGC
CCAGCCTGGCTGCGGCAGTAGACGCCGAGCACTTCAAATTGTTCTGCACCCCGGCGATCAATCTGTTCCC
GCGCCGCGCCGATCGCATCCATCTGCAGGCCGGGTTGCACGAGTACCACGTGCTGGCCGACCGCACCCGG
CCGATGGATTTCGAGATCCATCACCTGGGCGAGGTCGAAGGCTTCGGCGATCGTCAGGAGCCCGAGCAAT
GCTTCACCGCGTTCTATGGTGGCGACGCACGCACCTGGCATGCACGGCATGGCGCGTTCTACAGCATGCG
CCGTGAACCGCGCATGCTATCGGCACGTCAGCGCCGCGATGGCGCGCGGTCGAGCTATGTGGGCAGCGAA
GTCTTCGTCAGCCTGGTCGATGCCGACGATCAGGCCCACAGCACGCGCCTGCGTCAGCTTGGGCTGCAAC
TGTGGTGCAGCAACCGCGATCTGCCGCTGCATATGCCGGTAGGCAAGGGCGCAAGCGACTTCACCATGGA
CAGCGGCGTGCCGGTACGGAGCGTGCGCTGCGTGGCCGGGCCGACCAAGCCGCGCCCGGCATTGTCGGAT
GGGCAGACTGCGTGGCGCCTGCTCAGTCAATTGCAGCTCAATTATCTGTCGCTGTTCGAAGATGGCCCCG
ACGGCGCCGCTGCGCTACGCGAGATCCTCGCCCTGTATTGCGACCCGTTCGACGCGTCCGCGCAGCGGCA
GATCGAAGGCGTCAAGCAGGTGAGCGGCACACCGATCGTGCGGCGCATTCCGGTGCCGGGTCCGATCACC
TTCGGCCGCGGCCTGGAGATCACGCTGACCTGCGAGGACGCCGCCTTCGAAGGCACTGGCGCCTTCCTGC
TGGCTTCGGTGCTGCGGCACTTCTTCGCGCGCTATGTCTCGGTGAATTCCTTTACCGAAACCGTGCTGCG
TACCACCGAACGCAACGAGGTGGCCCGGTGGCCAGCCCAGCCCGGCACGCGCCCGCGCCTGTGA