SecReT6
Protein ID: 21244860
SecReT6 ID28
T6SS typei3
Gene symbol-
Locus tagXAC4143
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4871259..4871762 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ8PF43
KEGG IDxac:XAC4143
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-22, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|21244860|ref|NP_644442.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MAELTTTERLQPSLLDRLTDAAPSQREESREQRVISATRLRECVIRDLSWLLNAVNLETSRPLEAHPQVR
SSVLNYGIPDLAGVAVSGIDAAALQQRIRQAILAFEPRLIPETLRVSVHADAARMDRRSLLFTIESEMWA
QPLPLNLYLKTALDLETGRLDVVEGNG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4871762-4871259 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGGCCGAACTCACCACCACCGAACGCTTGCAGCCTTCGCTGCTGGACCGGCTCACCGATGCAGCGCCCA
GTCAGCGCGAAGAGAGCCGCGAGCAACGCGTGATTTCGGCCACGCGCCTGCGTGAGTGCGTCATTCGCGA
TCTGTCGTGGTTGCTCAATGCCGTGAACCTGGAAACCAGCCGCCCGCTGGAAGCGCATCCGCAGGTGCGC
AGCTCGGTACTGAATTACGGCATCCCTGATCTGGCCGGCGTCGCAGTGAGCGGCATCGATGCGGCCGCGC
TGCAACAGCGCATTCGCCAGGCGATTCTGGCCTTCGAGCCGCGGCTGATTCCCGAGACGCTGCGGGTGAG
CGTGCATGCCGATGCCGCACGCATGGACCGGCGCTCGCTGTTGTTCACCATCGAATCGGAGATGTGGGCG
CAGCCGCTGCCACTGAACCTGTATCTGAAGACTGCGCTGGATCTGGAAACAGGCCGGCTCGATGTCGTCG
AAGGGAACGGCTGA