SecReT6
Protein ID: 21244861
SecReT6 ID28
T6SS typei3
Gene symbol-
Locus tagXAC4144
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4871768..4872607 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ8PF42
KEGG IDxac:XAC4144
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.40E-42, Aligned region: 154..276
TPR_16 [PF13432], Evalue: 2.70E-05, Aligned region: 20..74
TPR_16 [PF13432], Evalue: 2.70E-05, Aligned region: 122..164
Protein Sequence: 279 a.a.     [Download]
>gi|21244861|ref|NP_644443.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MPRMAPPPSSIRNRAMDATAQTLLAQGEPAQALQQLIQQVRRQPADAAQRVFLFQLLAVLGQWSRAADQL
RACGELDATTQPLVHTYLAVLQGEQTRAEVFAGKRLPRVMGEPAEWLAMHLQALQLAAQGHGEQAAALRA
QAFERAPASAGVLNGERFQWLADADTRFGPCIELILDSGYAWAPLSQIQQLRMQAPLDLRDTVWAPVSVL
WRNGGQAFGYLPVRYPGSEHLDAGELQLARRTEWTLVAQGEIGMGQRMWSTESREIALLDVRDVQFDAG
 
Nucleotide Sequence: 840 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4872607-4871768 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGCCGCGCATGGCGCCGCCACCTTCTTCGATAAGGAACCGCGCGATGGATGCCACCGCACAGACCCTGC
TTGCCCAAGGCGAGCCGGCGCAGGCGTTGCAGCAACTGATCCAGCAGGTGCGCCGGCAACCGGCCGATGC
AGCGCAGCGCGTGTTTCTGTTTCAGTTGCTGGCCGTCCTCGGCCAGTGGTCGCGCGCCGCAGATCAGCTG
CGTGCTTGCGGTGAACTGGATGCCACCACGCAGCCCTTGGTCCACACCTATCTGGCGGTATTGCAGGGCG
AGCAGACGCGCGCCGAGGTGTTTGCCGGTAAGCGGTTACCGCGCGTGATGGGTGAGCCGGCCGAGTGGCT
GGCAATGCATCTGCAGGCGCTGCAACTGGCGGCGCAAGGGCATGGCGAACAAGCAGCGGCGTTGCGGGCG
CAGGCCTTCGAACGGGCACCAGCCAGTGCCGGCGTGCTCAATGGCGAACGCTTCCAATGGCTCGCAGATG
CCGACACCCGTTTCGGGCCCTGTATCGAGCTCATTCTCGATAGCGGCTATGCATGGGCCCCGCTCAGCCA
GATCCAGCAGCTGCGCATGCAGGCGCCGCTGGATCTGCGCGACACCGTGTGGGCGCCGGTGAGCGTGCTG
TGGCGCAACGGCGGCCAGGCCTTCGGCTACTTGCCGGTACGTTACCCCGGCAGCGAGCACCTGGATGCCG
GCGAGCTGCAACTGGCGCGCCGCACCGAATGGACCCTTGTCGCACAAGGCGAGATCGGCATGGGCCAGCG
CATGTGGAGCACCGAGTCGCGCGAGATTGCGCTGCTGGATGTGCGCGATGTGCAGTTCGACGCGGGCTGA