SecReT6
Protein ID: 21244863
SecReT6 ID28
T6SS typei3
Gene symbol-
Locus tagXAC4146
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4873345..4874838 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ8PF40
KEGG IDxac:XAC4146
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-193, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.00069, Aligned region: 20..58
BMFP [PF04380], Evalue: 0.00069, Aligned region: 60..90
Protein Sequence: 497 a.a.     [Download]
>gi|21244863|ref|NP_644445.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MSATEAALATRSIETTERGDFAALLNREFRPKSERAKEEVESAVRTLAEQVLNRSDVVGEDVSQTIKAYI
AEIDRTLTEQLNQILHHADLQQLEGAWRGLHYLVNNTETDQQLKIRVLNISKKELGKVLKRYKGTAWDQS
PIFKKVYEQEYGQLGGEPYGCLVGDYYFDQSPPDVELLNGIAQVAAAAHAPFIAAAAPKLMGMDNWSELS
NPRDLAKIFSTPDYAAWRSLRESEDSKYIGLAMPRTLSRLPYGAATSPVEDFDFEEDTAGADSNKYTWQN
AAYAMAVNINRSFKQYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEVAITDRRSAELDKMGLM
PLVHRKNSDMAAFISAQSLNKPDEYDDPDATANAALGARLPYMFACCRFAHYLKCIVRDKIGSFSDREQM
QSWLTRWVTQYIDGDPSNSSEETKARKPLAAAEVVVEEVEGAPGYYSSKFFLKPHYQLEGLTVSLRLVSR
LPSAAKA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4874838-4873345 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGTCCGCGACCGAAGCCGCACTGGCCACCCGTAGCATCGAAACAACCGAGCGGGGCGACTTTGCCGCGC
TGCTCAATCGCGAGTTCCGTCCCAAGAGCGAGCGCGCCAAGGAAGAAGTGGAATCGGCGGTGCGCACGCT
CGCCGAGCAGGTGCTCAACCGCAGCGATGTGGTTGGCGAAGACGTATCGCAGACCATCAAGGCCTACATC
GCCGAGATCGACCGCACGCTCACCGAACAGCTCAACCAGATCCTGCATCACGCCGATCTGCAACAGCTCG
AAGGCGCCTGGCGCGGCCTGCATTATCTGGTCAACAACACCGAGACCGACCAGCAGCTCAAGATCCGCGT
GCTGAATATCAGCAAGAAAGAGTTGGGCAAGGTACTCAAACGCTACAAGGGTACCGCGTGGGATCAGAGC
CCCATCTTCAAGAAAGTCTACGAACAGGAATATGGCCAGCTTGGCGGCGAGCCGTATGGGTGCCTGGTCG
GCGATTATTACTTCGACCAGAGTCCGCCGGATGTGGAACTGCTCAACGGTATTGCGCAGGTGGCCGCTGC
CGCGCACGCACCGTTCATTGCCGCCGCCGCGCCCAAATTGATGGGCATGGACAACTGGAGCGAGCTCTCC
AATCCGCGCGATCTGGCCAAGATTTTTTCCACGCCCGATTACGCTGCATGGCGCTCGCTGCGCGAATCCG
AAGACTCCAAGTACATCGGTCTGGCCATGCCGCGCACGCTCTCGCGTCTACCTTACGGCGCGGCCACCAG
CCCGGTGGAAGACTTCGATTTCGAGGAAGACACCGCCGGCGCGGATTCCAACAAGTACACCTGGCAGAAT
GCCGCCTATGCGATGGCGGTGAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCGCATTCGCG
GTATCGAGTCCGGCGGCGCAGTGGAAGGGTTGCCCACGCATACCTTTCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAAGTGGCGATCACCGACCGTCGCTCCGCCGAACTGGACAAGATGGGCCTCATG
CCGCTGGTACATCGCAAGAACTCGGACATGGCCGCCTTCATCAGCGCGCAGTCGCTCAACAAGCCCGACG
AATACGACGACCCGGATGCCACCGCCAACGCAGCATTAGGCGCGCGCCTGCCCTACATGTTTGCGTGCTG
CCGCTTTGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCTCCGATCGCGAGCAGATG
CAGAGCTGGCTGACACGCTGGGTGACGCAATACATCGACGGCGACCCGTCCAACTCCAGCGAAGAAACCA
AGGCGCGCAAGCCGCTGGCTGCCGCCGAAGTGGTGGTGGAAGAAGTGGAAGGCGCGCCTGGCTACTACAG
CTCCAAGTTCTTCCTCAAGCCGCATTACCAGCTGGAGGGCCTGACCGTGTCGTTGCGGTTGGTCTCGCGG
TTGCCCTCGGCCGCCAAGGCCTGA