SecReT6
Protein ID: 21244864
SecReT6 ID28
T6SS typei3
Gene symbol-
Locus tagXAC4147
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4874842..4875351 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ8PF39
KEGG IDxac:XAC4147
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-59, Aligned region: 8..159
Protein Sequence: 169 a.a.     [Download]
>gi|21244864|ref|NP_644446.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKALEIDVDNFDSR
LQSMGPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLLEARTQLANLDTYMDGKAGAE
QLIANAIRDPALLQSLVSAGKPASEPEGT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4875351-4874842 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGGCCAGCAGTCAGAAGTTCATCGCCCGCAATCGGGCGCCACGGGTGCAGATCGAATACGACGTGGAGG
TCTACGGCGCGCAGAAGAAGGTGCAGATTCCGTTCGTGATGGGGGTGATGTCGGATCTGTCCGGCGCCAA
CGCCGGTGAGCTGCCCTCGCTGGATGAGCGCAAGGCACTGGAGATCGACGTCGACAACTTCGACAGCCGT
CTGCAGTCGATGGGCCCGCGCGCGCAATTCAAGGTGCCCAACACGCTCACCGGCGAAGGCGAGCTGGCGG
TGGATATCACCTTCGAAAGCATGGACGACTTTTCGCCGGCCGCCATCGCGCGCAAGGTTGCGCCGTTGGC
CAAATTGCTGGAAGCGCGCACGCAGTTGGCCAACCTGGACACCTACATGGACGGCAAGGCCGGTGCAGAG
CAGCTGATCGCCAACGCTATCCGCGATCCGGCGTTGCTGCAGTCGCTGGTGTCGGCCGGCAAGCCCGCGT
CCGAACCGGAAGGAACCTGA