SecReT6
Protein ID: 213156435
SecReT6 ID311
T6SS typei4b
Gene symbol-
Locus tagAB57_1479
StrainAcinetobacter baumannii AB0057
Repliconchromosome [GenBank: NC_011586] [Browse all T6SS(s) in this replicon]
Location [Strand]1559693..1560196 [+]
Producttype VI secretion protein, family
NoteTssB
UniProt IDB7I1Y8
KEGG IDabn:AB57_1479
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|213156435|ref|YP_002318855.1| type VI secretion protein, family [Acinetobacter baumannii AB0057]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|213155370|ref|NC_011586.1|:1559693-1560196 Acinetobacter baumannii AB0057 chromosome, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCTGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGACCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCGGAGG
CCGATCATGAATAA