SecReT6
Protein ID: 213156439
SecReT6 ID311
T6SS typei4b
Gene symbolvasA
Locus tagAB57_1483
StrainAcinetobacter baumannii AB0057
Repliconchromosome [GenBank: NC_011586] [Browse all T6SS(s) in this replicon]
Location [Strand]1562795..1564606 [+]
Producttype VI secretion protein, family
NoteTssF
UniProt IDB7I1Z2
KEGG IDabn:AB57_1483
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-155, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|213156439|ref|YP_002318859.1| type VI secretion protein, family [Acinetobacter baumannii AB0057]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQDVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLKRIPQHVSELELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|213155370|ref|NC_011586.1|:1562795-1564606 Acinetobacter baumannii AB0057 chromosome, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGGGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATTGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGACATTTTCCTGCGTGTTCAGTTGTTA
GTTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTCGTACCTCACCATACGGTTTTGAA
ATCTCGTAGTTTCAAAGGGGTGCAGTGTGAGTTTAATACAACTCAAGATGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAACAATTGTAGAATTGAGCAAGAATCCATTCGAATTGATTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTAGATTTTTTAAAGCGAATACCTCAGCATGTATCCGAACTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCAGTAATTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCATAA
GCAATTAGAATATCCTTTAGTTACAGATGCACATCATCCTGAGTTTTATCAGGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAAGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCCATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACC
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACCAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTGGCGCTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGTTGGCTTTATATAACTTACCGCAGTCAAAAGAAAATTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCGCTTACCCATAAACTTGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTGAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA